KEGG   Burkholderia pseudomallei 668: BURPS668_A0503Help
Entry
BURPS668_A0503    CDS       T00481                                 

Gene name
selD
Definition
(GenBank) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00450  Selenocompound metabolism
bpd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BURPS668_A0503 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bpd03016]
    BURPS668_A0503 (selD)
Enzymes [BR:bpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     BURPS668_A0503 (selD)
Transfer RNA biogenesis [BR:bpd03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BURPS668_A0503 (selD)
 Prokaryotic Type
    BURPS668_A0503 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ABN85539
UniProt: A3NGN8
Position
II:457003..458073
Genome map
AA seq 356 aa AA seqDB search
MAMTETKQTDAAAPRLTSLSHGGGCGCKIAPGVLSELLRRTAPPALFPDLLVGTETSDDA
AVYRLNDEQAIVATTDFFMPIVDDPFDFGRIAATNALSDVYAMGGKPILALALVGMPINV
LPHETIAAVLRGGEAVCADAGIPVAGGHSIDSVEPIYGLAALGVVHPARVKRNAAARAGD
VLVLGKPLGVGVLSAALKKDRLDAQGYAQMIATTTKLNRPGTALAALPGVHALTDVTGFG
LLGHTLELARGAGLTARVRYGALPWLAGVEALVADGVLTGASGRNWAAYGHDVRLGDGLP
AVAQALLTDPQTSGGLLVACAPEAVDDVLACFRDDGFERAAAIGEMVDGAARVDVS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttggcgatgaccgagaccaagcaaaccgacgcggcggcgccgcgcctcacgagcctgtcg
cacggcggcggctgcggctgcaagatcgcgcccggcgtgctgtcggagctgctccggcgc
accgcgccgccggcgctctttcccgatctgctcgtcggcaccgagacgtccgacgacgcg
gccgtctatcgtctgaacgacgagcaggcgatcgtcgcgaccaccgatttcttcatgccg
atcgtcgacgatccgttcgacttcgggcggatcgccgcgacgaacgcgctgtccgacgtc
tacgcgatgggcggcaagccgatcctcgcgctcgcgctcgtcggcatgccgatcaacgtg
ctgccgcacgagacgatcgccgcggtgctgcgcggcggcgaggcggtgtgcgcggacgcg
ggcattcccgtcgcgggcggccattcgatcgattcggtcgagccgatctacgggctcgcg
gcgctcggcgtcgttcatccggcgcgcgtgaagcgcaatgcggccgcgcgcgcgggcgac
gtgctcgtgctcggcaagccgctcggcgtcggcgtgctgtccgccgcgctgaagaaggac
cggctcgatgcgcaaggctacgcgcaaatgatcgcgacgacgacgaagctcaaccggccg
ggcacggcgctcgccgcgctgccgggcgtgcacgcgctgaccgacgtgacgggcttcggc
ctgctcggccatacgctcgagctcgcgcgcggcgcggggctgaccgcgcgcgtgcgttac
ggtgcgctgccatggctcgcgggcgtcgaggcgctcgtcgccgacggcgtgctgaccggc
gcgtccgggcgcaactgggccgcgtacggtcacgacgtgcggctcggcgacgggctgccc
gccgtcgcgcaggcgctgctgaccgatccgcagacctcgggcgggctgctcgtcgcatgc
gcgccggaagcggtcgacgacgtgcttgcctgcttccgcgacgacggcttcgagcgtgcg
gcggcgatcggcgaaatggtcgacggggcggcgcgggtcgatgtgagctga

DBGET integrated database retrieval system