KEGG   Burkholderia pseudomallei 668: BURPS668_A0789
Entry
BURPS668_A0789    CDS       T00481                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bpd  Burkholderia pseudomallei 668
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABN85961
UniProt: A3NHG7
Position
II:758487..759035
AA seq 182 aa
MVRQKDGQKFIGESRAPRVQIEYDVEVYGSQKKVELPFVAGVMADLSGDNVEPLGPVEDR
RFQEIDVENFDERMAQIAPSLSYHVKNVLTNDGTLIPIDLTFTSMESFEPADVVKRIPEL
STLLEARNRLKELLTYMDGKAAAEDVIQELLKSPQWANEADAAEQSGGAGEGGDHQPEEG
AK
NT seq 549 nt   +upstreamnt  +downstreamnt
atggttcgacaaaaggatggacagaaattcatcggggagagtcgtgcgccccgcgtgcag
attgaatacgacgtggaggtgtacggctcgcagaagaaggtcgagctgccgttcgtcgcg
ggcgtgatggcggacctgtcgggcgacaacgtcgagccgctcggcccggtcgaggatcgg
cgctttcaggagatcgacgtcgagaacttcgacgagcgcatggcgcagatcgcgccgtcg
ctgagctatcacgtgaagaacgtgctgaccaacgacggcacgctgattccgatcgatctg
acgttcacgtcgatggaatcgttcgagccggcggacgtcgtcaagcgcattcccgagctg
tcgacgctgctcgaggcgcgcaaccggctgaaggagctgctgacctacatggacggcaag
gcggcggccgaggacgtgatccaggaattgttgaagagcccgcagtgggcgaacgaggcc
gacgcggcggagcaatccggcggcgccggcgagggtggagaccatcaaccggaagagggt
gcgaaatga

DBGET integrated database retrieval system