KEGG   Burkholderia pseudomallei 668: BURPS668_A1004Help
Entry
BURPS668_A1004    CDS       T00481                                 

Gene name
asnB
Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00250  Alanine, aspartate and glutamate metabolism
bpd01100  Metabolic pathways
bpd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BURPS668_A1004 (asnB)
Enzymes [BR:bpd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BURPS668_A1004 (asnB)
Peptidases [BR:bpd01002]
 Cysteine Peptidases
  Family C44
   BURPS668_A1004 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 NAD_synthase QueC tRNA_Me_trans DUF2795 DUF3700
Motif
Other DBs
NCBI-ProteinID: ABN87987
UniProt: A3NI32
Position
II:970875..972845
Genome map
AA seq 656 aa AA seqDB search
MCGITGFVGPVACAPQTARATLARMTDSLAHRGPDDTGLWIDHDAGVALGHRRLSIVDLS
EHGHQPMLSACGRYAMTFNGEIYNFRELRSELEREHRAPEWRGHSDSEVLLAAFCAWGVD
RALQKAVGMFALALWNRESRVLTLARDRIGEKPLYYGRIGGSFVFGSELKALRRFPGFDA
HPIDRDALCLYLRHASVPAPYTIYEGIRKLPPGTYAQLEDLAEAPAPRRYWSLERAIAAG
RANPFDGDANAAVAQLDHVLRDAIAEQSVADVPLGAFLSGGVDSSVIVALMQTQTAQPVQ
TFTIGFHEAGYDEAGYAKAVARHLGTSHTELYVKPADVLATVPRMPCVYDEPFADSSQIP
TLLVSELTRRHVKVSLSGDGGDELFGGYTRYFLTPRLWGRLRRVPAAVRMRIAAALHALR
PDHADQIASLVQGAWSASAQRDASPRVGDRLHKLANVMTADSRASLYRLLMSSVHHPERF
TLAGHEPQTLIDTPGAWPPGLSFAEQAMAVDTLTYLPTDILTKVDRAAMAVSLETRMPFL
DHRVVEFAWRLPEALRIPDGQDKWLLRKLLYRYVPRPLIDRPKQGFCAPVGAWLRGELSD
WAAELLRPARLRDEGYLDAARVERLWRQHQSGRMNWQHPLWTVLMFQAWLERQRAE
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcaccggcttcgtgggccctgtcgcatgcgcgccgcagacggctcgcgcg
accctcgcgcgaatgacggacagtctcgcgcatcgcggcccggacgataccggtttgtgg
atcgatcacgacgcgggcgtcgcgctcggccatcggcgcctgtcgatcgtcgacttgtcc
gagcacgggcatcagccgatgctgtccgcgtgcggccgttatgcgatgacgttcaacggc
gagatctacaactttcgcgagttgcgcagcgagctcgagcgcgaacatcgcgcgcccgaa
tggcgcggtcattcggatagcgaagtgttgctcgcggcgttctgcgcgtggggcgtcgat
cgcgcgttgcaaaaggcggtcggcatgttcgcgctcgcgctgtggaaccgcgaatcgcgc
gtgctcacgctcgcgcgcgatcgcatcggcgagaagccgctctattacggccgcatcggc
ggctcgttcgtgttcggctccgagctgaaggcgctgcggcgttttcccggcttcgacgcg
catccgatcgaccgcgacgcgctgtgcctgtatctgcgccacgcgagcgtgcccgcgccg
tacacgatctacgaaggcatccgcaagctgccgcccggcacgtacgcgcagctcgaggac
ctcgccgaagcgcccgcgccgcgccgctactggtcgctcgagcgcgcgatcgccgcaggc
cgcgcgaatccgttcgacggcgacgcgaacgccgccgtcgcgcagctcgatcacgtgttg
cgcgacgcgatcgccgagcagtcggtcgccgacgtgccgctcggcgcgttcctgtcgggc
ggcgtcgattcgtcggtgatcgtcgcgttgatgcagacgcagaccgcacagccggtgcag
accttcacgatcggctttcacgaggcgggctacgacgaggccggctatgcgaaggcggtt
gcgcggcatctgggcacgtcgcacaccgagctctacgtgaagccggccgacgtgctcgcg
accgtcccgcgcatgccgtgcgtctacgacgagccgttcgccgattcgtcgcagattccg
acgctgctcgtctccgagctcacccgccggcacgtgaaggtgagcctgtccggcgacggc
ggtgacgagctgttcggcggctacacgcgctatttcctgacgccgcgcctatgggggcgg
ctgcgccgcgtgccggccgcggtgcggatgcggatcgcggccgcgctgcacgcgctgcgg
cccgaccatgcggatcagatcgcctcgctcgtgcagggcgcgtggagcgcgtccgcgcag
cgcgacgcgtcgccgcgcgtcggggaccgcctgcacaagctcgcgaacgtgatgacggcg
gacagccgcgcgtcgctgtaccggttgctgatgtcgtcggtccatcatccggagcgcttc
acgctcgcggggcacgagccgcagacgctgatcgacacgccgggcgcgtggccccccggg
ctgtcgttcgccgagcaggccatggccgtcgatacgctcacgtatctgccgaccgacatc
ctgacgaaagtcgaccgcgcggcgatggcggtgagcctcgagacgcggatgccgtttctc
gatcaccgcgtcgtcgagttcgcgtggcggctgccggaggcgctgcgcatcccggatggg
caggacaagtggttgctgcgcaagctgctgtaccgctacgtgccgcgcccgctgatcgac
cggccgaaacagggcttctgcgcgcccgtcggcgcgtggctgcgcggcgaattgagcgac
tgggcggcggagctgctgcgccccgcgcgcctgcgcgacgaaggctacctcgacgcggcg
cgcgtcgagcgcctgtggcggcagcaccagtcgggccggatgaactggcagcacccgctc
tggacggtgctgatgttccaggcatggctcgagcggcagcgcgccgagtag

DBGET integrated database retrieval system