KEGG   Burkholderia pseudomallei 668: BURPS668_A1215Help
Entry
BURPS668_A1215    CDS       T00481                                 

Definition
(GenBank) selenocysteine lyase
  KO
K04127  isopenicillin-N epimerase [EC:5.1.1.17]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00311  Penicillin and cephalosporin biosynthesis
bpd01100  Metabolic pathways
bpd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    BURPS668_A1215
Enzymes [BR:bpd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.17  isopenicillin-N epimerase
     BURPS668_A1215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP Aminotran_1_2 DegT_DnrJ_EryC1 SPOR Tcell_CD4_C
Motif
Other DBs
NCBI-ProteinID: ABN86746
UniProt: A3NIP1
Position
II:1155898..1157055
Genome map
AA seq 385 aa AA seqDB search
MTAPLKSLFLLDPSVTYLNHGAYGATPRPVFERHVQWQYELEREPVDFLSRRFAERMAQA
RAILAEYVDTERDNLVYVSNGTTGVNIVARSLPLGPGDELLTTDHEHGGIERLWRFTAQK
RGFEIVRHKVPLPVTTHARFIEDFWRDVTPRTRAILISQLTSPTALVFPVAAICARARAR
GILTIVDGSHVPGQLPLSLREMDPDFYVGILHKWVCAPKGSAFLYARPDVQPLVEPLVVS
WGWEPKNPGPSKFVEYHEWQGSRDISAFLSVPSAIAFQREHDWDGVRKRCIALASDAQRE
VAALTREPLYHPPGAHEWHGQMVCAQLPPQTDDIALLARLRNECGIDVSVDRFGGRPRIR
VSIQGYNGPDDVDRLLGSLKQLLRL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacagccccactgaaatcgttgtttcttctcgacccgagcgtgacctatctgaaccac
ggcgcgtacggcgcgacgccgcgcccggtgttcgagcgccacgtgcagtggcagtacgag
ctcgaacgcgagccggtcgatttcctgtcgcgccgcttcgccgaacgcatggcgcaggcg
agggcgatactggccgaatacgtggataccgaacgcgacaatctagtatatgtgagcaac
ggcaccacgggcgtgaacatcgtcgcgcgcagcctcccgctcggcccgggcgacgaactg
ctcaccaccgatcacgagcacggcggcatcgagcggctgtggcgcttcaccgcgcaaaag
cgcgggttcgagatcgtccggcacaaggtgccgctgccggtgacgacgcatgcccggttc
atcgaggatttctggcgcgacgtgacgccgcgcacgcgcgcgatcctgatcagccagctg
acgtcgcccaccgcgctcgtgtttccggttgcggcgatctgcgcgcgcgcgcgggcgcgc
ggcatcctgacgatcgtcgacggctcgcacgtgcccgggcaactgccgctgtcgctgcgc
gagatggatccggatttttatgtcggcatcctgcataaatgggtgtgcgcgccgaagggc
agcgcgttcctgtatgcgaggccggacgtgcagccgcttgtcgagccgctcgtcgtcagt
tggggctgggagccgaagaacccggggccgtcaaagttcgtcgagtatcacgagtggcag
ggcagccgcgacatctccgcgttcctgagcgtgccgagcgcgatcgcgtttcagcgcgag
cacgactgggacggcgtgcgcaagcgctgcatcgcgctcgcgagcgacgcgcagcgcgaa
gtggccgcgttgacgcgcgagccgctctaccatccgccgggcgcacacgagtggcacggc
cagatggtctgcgcgcaactgccgccgcagacggacgacatcgcgctgcttgcccgcttg
cgcaacgaatgcgggatcgacgtctcggtcgaccgtttcggcggccggcctcgcatccga
gtgtcgattcagggctataacggcccggacgacgtcgatcgattgctcggcagtctgaag
caactgctgcggctttga

DBGET integrated database retrieval system