KEGG   Burkholderia pseudomallei 668: BURPS668_A1695
Entry
BURPS668_A1695    CDS       T00481                                 

Definition
(GenBank) type V secretory pathway, adhesin AidA
Organism
bpd  Burkholderia pseudomallei 668
SSDB
Motif
Pfam: DUF3274 YbjQ_1
Other DBs
NCBI-ProteinID: ABN87356
UniProt: A3NK19
Position
II:complement(1646115..1647458)
AA seq 447 aa
MVERFRFHRLILRDHTRQRDSAVTSEPHTIPELAELMIDSAHSCGRAGQNWSKTQGKRPD
KGGKHWITFDERDNRGKVYLYFCPEDTVVGLDKVRGIGTFGVPDEVPADGAAASRGKTMP
AMTVLEPKRFFQRMWTRLERDQDGRGKRSKVAVGTPPARVPVRDPFQRLTPGPDTDGTML
GTLVESGKNMALQASFKRNDIRFINGEQLKPAYEPDLYGGEVRKGGQVPGHADVAGLMRP
DDVTKNVALGNQYAKFKWKDVATTGDPGAGIEPHKQAFNRGRPVDEQSHNWRIVPSRSLG
SMLSAAATGGRYQTYVIQREETPDEVRKRMRTDADQLEANNYHSGVLLSSENHRWVTAMD
VAIGQAVTLDDPDWRQLLLLMADWKMTPDVYRNIQKCKNFERLDEHTREFVKACVDYYKT
GRFPDEKYVPLTMPPLVTSELKVESKT
NT seq 1344 nt   +upstreamnt  +downstreamnt
gtggtagagcgctttcggtttcatcgcctcatcttacgcgaccacacccgccaacgtgac
agcgccgtgacgagcgagccgcatacgattccggagctggccgaactgatgatcgattcg
gcccattcgtgcggccgggccggacagaactggagcaagacgcagggaaagcggccggac
aagggcggcaagcactggatcacgttcgacgagcgcgacaaccgcggcaaggtctatctg
tacttttgcccggaagataccgtggtcggcctcgacaaggtgcgggggatcggcacgttc
ggcgtgcccgacgaggtgccggccgatggcgcggcggccagccggggcaaaacgatgccc
gcgatgacggtgcttgagccgaagcgcttctttcagcgcatgtggacgcggctcgagcgc
gaccaggacggcagggggaagcgctcgaaggtcgccgtcggcacgccgcccgcgcgcgtg
ccggttcgcgacccgtttcagcgattgacgccgggccccgacacggacggcacgatgctt
ggcaccttggtcgaatccggcaagaacatggcgctgcaggcatcgttcaagcgcaacgac
attcgcttcatcaacggcgagcaactgaaaccggcgtacgagcccgatctgtacgggggc
gaggttcggaagggcggacaggtgcccgggcacgccgatgtcgccgggttgatgcgtccg
gacgacgtgacgaaaaacgtcgcgctcggcaaccagtacgcgaagttcaaatggaaagac
gtcgcgacgacgggcgatccgggcgccggcatcgagccgcacaagcaggcgttcaatcgc
gggcgtccggtcgacgagcagtcgcataactggcgcatcgtgccgagccggtcgctcggc
tcgatgctgtcggcggccgccacgggcggacggtatcagacgtacgtgatccagcgcgag
gagacgccggacgaggttcgcaagcgcatgcgcaccgatgccgatcaactggaagcgaac
aactatcattcgggcgtgctgctcagttcggagaaccatcgctgggtcacggcgatggac
gtggcgatcggtcaggcggtgacgctggatgatccggactggcggcagttgttgcttttg
atggcggattggaagatgacgccggacgtgtatcgcaatatccagaaatgcaagaacttt
gagcgcttggacgaacacacgcgcgaattcgtgaaagcgtgtgtcgattactacaagacg
ggccgatttcccgacgagaagtatgtacctctcaccatgccaccgctcgtgaccagcgaa
ctgaaggttgagagcaaaacatga

DBGET integrated database retrieval system