KEGG   Burkholderia pseudomallei 668: BURPS668_A2018
Entry
BURPS668_A2018    CDS       T00481                                 
Name
(GenBank) nucleoside-diphosphate-sugar epimerase
  KO
K22025  D-erythronate 2-dehydrogenase [EC:1.1.1.410]
Organism
bpd  Burkholderia pseudomallei 668
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BURPS668_A2018
Enzymes [BR:bpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.410  D-erythronate 2-dehydrogenase
     BURPS668_A2018
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 KR NAD_binding_10 Ldh_1_N adh_short
Other DBs
NCBI-ProteinID: ABN85452
UniProt: A3NKZ2
Position
II:1951265..1952236
AA seq 323 aa
MKVLITGGAGFLGQRLAKQLLARGELTGPNGAPRRIAELVLLDVVQAHDFDDARVTARVG
DIADRAVLEAAIDARTHAVFHLAAIVSGQAEADFDLGMRINLDASRLLLDVCRARGHRPR
VVFTSSVAVYGGALPELVRDDTALEPQSSYGAQKAIAELLLSDYTRRGFVDGRVLRLPTI
SVRPGRPNAAASSFASGIVREPLNGEQAVCPVPGGTRLWLLSPRRAIDALIAGCELDGAA
LGNRRAINLPGLSVTVDDMIDALREVAGIEAVKLIRRAEDERVVKIVGSWPGRWDTSRAE
ALGLAGDASFVDVIRGYLEDERR
NT seq 972 nt   +upstreamnt  +downstreamnt
atgaaggttctcatcaccggcggcgccggctttctcggccagcgtctcgcgaaacagctg
ctcgcgcgcggcgagctgaccggcccgaacggcgcgccgcgacgcatcgccgagctcgtg
ctgctcgacgtcgtccaggcccacgacttcgatgatgcgcgcgtgacggcgcgcgtcggc
gacatcgccgatcgcgccgtgctcgaggccgcgatcgacgcgcgcacgcacgcggtcttc
catctcgcggcgatcgtgagcggccaggcggaagccgatttcgacctcgggatgcggatc
aacctcgatgcgtcgcgcctgttgctcgacgtgtgccgcgcgcgcgggcaccggccgcgc
gtggtgttcacgagctcggtggcggtgtacggcggcgcgctgcccgaactcgtgcgggac
gacaccgcgctcgaaccgcagtcgtcgtacggcgcgcagaaggcaatcgccgagttgctg
ctgtccgattacacgcgccgcggcttcgtcgacgggcgcgtgctgcggctgccgacgatc
agcgtgcggccgggccggccgaacgcggcggcttcgtcgttcgcgagcgggatcgtccgc
gagccgctgaacggcgagcaagccgtatgcccggtgccgggcggcacgcggctgtggctg
ttgtcgccgcgccgcgcgatcgacgcgctcatcgccggctgcgagctcgacggcgcggcg
ctcggcaaccggcgcgcgatcaacttgccggggctctcggtgacggtcgacgacatgatc
gacgcgctgcgcgaagtcgccggcatcgaagcggtgaagctgatccggcgcgccgaggac
gagcgcgtcgtgaagatcgtcggcagctggccgggacgctgggacacgtcgcgcgccgaa
gcgctcggcctcgcgggcgacgcgagcttcgtcgacgtgatccgcggctatctcgaagac
gagcggcgataa

DBGET integrated database retrieval system