KEGG   Burkholderia pseudomallei 668: BURPS668_A2130
Entry
BURPS668_A2130    CDS       T00481                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BURPS668_A2130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpd02044]
    BURPS668_A2130
Secretion system [BR:bpd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS668_A2130
SSDB
Motif
Pfam: Phage_GPD Phage_base_V LmeA
Other DBs
NCBI-ProteinID: ABN87281
UniProt: A3NLA3
Position
II:2067163..2070186
AA seq 1007 aa
MPSSPRHDAPASRANAAPSANARRFTFASDAYDPATFDVVDINGRDAISQPYRFEITLVS
RQLRIDFAKMLSRGATLAILPPFGEAGTTRYAGVLAEFEQKKRFRDFTVYRATLVPRLWR
LSLYKASDVYLNEQTIPDIVKRVLRAASFGSRDFRMRHGGGYRKRSFVCQYDESHLDFVS
RWMEKEGLYYYFEHDGRHETLVIVDDRRHQPGPADDLALRYRPATSLDAGIEADRVQAFT
CRATPLPREVVLRDFNHRKAELSLEVRERVARDGVGERVSSDEHFHTKDEGRRYAKLRAE
ALVCEGRRFAGESTAAGLRAGRFFALSGHYREDFDGRYLVTALTHRGSQAHLMFPDLDAP
FGATPGEPIYRAEFEAIAADLQYRPPRTTPKPRAAGVVSAIVDGEGGGKLAELDEYGQYK
VRFPFAHTAHPANKASARIRMATPYAGDDRGMHLPLVKRTEVKIAFDGGDPDRPVIVGAV
PNSSHRSVVTRRNPAEHRILTEHNQLYMKDGSGAATWLHAPNNHIGIGAVGPGDGLALLT
SGNKFDFSLGNAYSFSGGLKCSVSMGGNTDVYVGVRNSLDVSANFLTTLQGNLRWMLPGS
RSFEINDSASTLLQTLHKQSATGAIRLSAGQDASALLQKQLDKLKGTVRKFMIVSGLANA
GSAAAAAGLIKGGGKLADLPWAGFGISAAQFAGATGVSTALMATSRTLLANVAKLQEALP
LVADLSLGKQGIALAAKNLTHATRMSLTVDGVSWSAHAKGPGAAGAAMSVGKGRWGVEAA
KHAHVHASDTLLFAVPADPTTQFDLKDLIGLRRDLDECMKDIADLEADISENEVLSTDQN
TFGVSALIPTPPSPAGALAAVAIKVKQAKLVELKAKQKLVALKVDNLQQKFAKHVQHLSA
VRMSASDAQLGFKGNRLVATADGVTLAHAQGKAKLDVREAKIGVTAGKSSVELDEGKIAA
GCGSASLKLGSDGAIDVSATDVKLNGTNVKLNGSASLKFDGQLIQLG
NT seq 3024 nt   +upstreamnt  +downstreamnt
atgccttcgtccccccgccacgatgcgcccgcgtcgcgcgcgaacgccgcgccgtccgcg
aacgcgcgacgcttcacgttcgcgagcgacgcgtacgaccccgcgacgttcgacgtcgtc
gacatcaacggccgcgacgcgatctcgcagccgtaccggttcgagatcacgctcgtgagc
aggcagttgcggatcgacttcgcgaagatgctgagccgcggggcgacgctcgcgatcctg
ccgccgttcggcgaggccggcaccacccgctatgccggcgtgctcgccgaattcgagcag
aagaagcgctttcgcgacttcaccgtctatcgcgcgacgctcgtgccgcgcctctggcga
ctatcgctgtacaaggcgtcggacgtctatctgaacgagcagacgattcccgacatcgtc
aagcgcgtgctgcgcgccgcctcgttcggcagccgcgatttccgcatgcggcacggcggc
ggctaccgcaagcgcagcttcgtctgccagtacgacgagagccatctcgatttcgtgtcg
cgctggatggagaaggaaggcctctactactacttcgagcatgacggccggcacgaaacg
ctcgtgatcgtcgacgaccgccgccatcagcccggccccgccgacgatctcgcgctgcgc
taccgacccgcgaccagcctcgacgcgggcatcgaagcggaccgcgtgcaggcgttcaca
tgccgggcgacgccgctgccgcgcgaagtcgtgctgcgcgatttcaaccaccgcaaggcg
gagctctcgctcgaagtccgcgagcgcgtggcgcgcgacggcgtcggcgagcgggtgtcg
agcgacgagcacttccacacgaaggacgaagggcggcgctacgcgaagctgcgcgccgag
gcgctcgtctgcgaagggcgccgattcgccggcgaatcgaccgcggccgggctgcgcgcc
ggccgcttcttcgcgctgtcgggccactaccgcgaggatttcgacggccgctatctggtg
acggcgctcacgcatcgcggctcgcaggcacacctgatgtttcccgatctcgacgcgccg
ttcggcgcgacgccgggcgagcccatctaccgcgccgagttcgaggcgattgccgccgac
ctccagtaccggccgccgcgcacgacgcccaagccgcgcgcggcgggcgtcgtcagcgcg
atcgtcgacggcgagggcggcggcaagctcgcggagctcgacgaatacggccagtacaag
gtgcgctttccgttcgcgcacaccgcgcatccggcgaacaaggcctccgcgcgcatccgg
atggcgacgccctacgcgggcgacgaccgcggcatgcacctgccgctggtgaagcgcacc
gaagtgaagatcgcattcgacggcggcgatccggaccgccccgtgatcgtcggcgcggtg
cccaactcgtcgcaccgcagcgtcgtcacgcgccgcaaccccgccgagcatcgcatcctc
accgagcacaaccagctctacatgaaggacggcagcggcgcggcgacgtggctgcacgcg
ccgaacaaccatatcggcatcggcgcggtcgggccgggcgacggcctcgcgctcctcacg
tccggcaacaagttcgacttctcgctcggcaacgcgtacagcttctcgggcgggctcaag
tgctcggtgtcgatgggcggcaacaccgacgtctacgtcggcgtgcgcaacagcctcgac
gtcagcgcgaacttcctgacgacgctgcagggcaacctgcgctggatgctgcccggcagc
cggagcttcgagatcaacgacagcgcatcgacactgctgcagacgctgcacaagcagtcc
gcgacgggcgcgatccggctgtccgccgggcaggacgcgtccgcgctgctgcaaaagcag
ctcgacaagctcaagggcacggtgcgcaagttcatgatcgtgtcgggcctcgcgaacgcc
gggtccgcggccgccgccgcggggctcatcaagggcggcggcaagctcgccgatctgccg
tgggcgggcttcggcatatccgccgcgcagttcgccggcgcgaccggcgtcagcacggcg
ctgatggcgacctcgcgcacgctgctcgcgaacgtcgcgaagctccaggaggcgttgccg
ctcgtcgccgatctgtcgctcggcaagcagggcatcgcgctcgccgcgaagaacctcacg
cacgcgacgcggatgtcgctcaccgtcgacggcgtctcgtggtcggcgcacgcgaagggg
cccggcgcggcgggcgccgcgatgagcgtcggcaagggccgctggggcgtcgaagcggcg
aagcacgcgcacgtccacgcgagcgacacgctgctgttcgcggtgccggccgacccgacg
acccagttcgacctgaaggacctgatcgggctgcgccgcgatctcgacgaatgcatgaag
gacatcgccgatctcgaagccgacatttcggaaaacgaagtgctgtcgaccgatcagaac
acgttcggcgtcagcgcgctcatccccacgccgccgtcgcccgccggcgcgctcgcggcg
gtcgcgatcaaggtgaagcaagcgaagctcgtcgagctgaaggccaagcagaagctcgtc
gcgctgaaggtcgacaacctgcagcagaagttcgcgaagcacgtgcagcacctgagcgcc
gtgcggatgagcgcttccgacgcgcagctcggcttcaagggcaaccggctcgtcgcgacg
gccgacggcgtcacgctcgcgcatgcgcagggcaaggcgaagctcgacgtgcgcgaagcg
aagatcggcgtcacggcgggcaaatcgagcgtcgagctcgacgaaggcaagatcgcggcc
ggctgcggcagcgcatcgctgaagctcggcagcgacggcgcgatcgacgtgagcgcgacc
gacgtcaagctgaacggcaccaacgtcaagctgaacggcagcgcgtcgctgaagttcgac
ggccaactgatccagctcggctga

DBGET integrated database retrieval system