KEGG   Burkholderia pseudomallei 668: BURPS668_A2135
Entry
BURPS668_A2135    CDS       T00481                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bpd  Burkholderia pseudomallei 668
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ABN86145
UniProt: A3NLA8
Position
II:2075116..2075913
AA seq 265 aa
MNARHIAPPAATRARRPMQPGRPSWPSRTYRACAARTCAAVLVALAALAGCAARVTEEQA
RADVRWDYAPDALRIDIDASARLNEYLNAPHTLLLAVFQSADAKAFRQLADDPDRLRMTL
AAGGPAADFIQTTRYVVAPGQHVALSIDRAQQARYVGIVAGYYDADGPRAARLFEVPLRI
DKRGWFSSTYRAAPRTLELKLRLGAQSITDAREAPLNLPPPGARAWTALDSGAKTLALPS
ADANDGGSGKRDKRGNAAARAPRKQ
NT seq 798 nt   +upstreamnt  +downstreamnt
atgaacgcacgacacattgccccgccggccgcgacgcgcgcgcgccggccgatgcagccc
ggccggccgtcatggccgtcgcgaacgtatcgcgcatgcgcggctcgcacatgcgctgcc
gtgctcgtcgcgctcgccgccctcgccggctgtgcggcccgcgtcaccgaagagcaggcg
cgcgccgacgtgcgatgggactacgcgcccgacgcgctgcgcatcgatatcgacgcgtcg
gcgcggttgaacgaatacctgaacgcgccgcacacgctgttgctcgcggtgttccagagc
gcggacgcgaaggcgttccgccagctcgccgacgatccggaccggctgcgcatgacgctc
gcggcgggcggccccgccgcggacttcattcagacgacccgctacgtcgtcgcgcccggc
cagcatgtcgcgctgtcgatcgatcgcgcgcagcaggcgcgctacgtcggcatcgtcgcc
ggctactacgacgccgacggcccacgcgcggcgcgcctgttcgaggtgccgctgcgcatc
gacaagcgcggctggttctcctccacctatcgcgccgcgccgcgaacgctcgagctgaag
ctcaggctcggcgcgcagagcatcaccgacgcgcgcgaagcgccgctgaacctgccgccg
ccgggcgcgcgcgcatggacggcgctcgacagcggcgcgaaaaccctggcgctgccgagc
gccgacgcgaacgacggcggcagcggcaagcgcgacaaacgcggcaacgccgccgcccgt
gcgccgcgcaagcaatga

DBGET integrated database retrieval system