KEGG   Burkholderia pseudomallei 668: BURPS668_A2142
Entry
BURPS668_A2142    CDS       T00481                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bpd  Burkholderia pseudomallei 668
SSDB
Motif
Pfam: Big_5 UCH
Other DBs
NCBI-ProteinID: ABN86189
UniProt: A3NLB4
Position
II:2082514..2083911
AA seq 465 aa
MNARRPAFGLIASHASRRRAVESVRAHFPFMFTLCLAMKPTSNHSDPSGAPSSARRAASD
SSRLVRGMRSPQRGGAALALAVASLAGCGGGDSGEPAPREFAPPTVQLAYPTQPNSPVAP
APTAHVSSGHTPPATAPAAMPTASPTATAAASPSAPSTATPNAPPAAPLAVVATRVPPTH
AALRRPTIELEFDRAIEPGSVPHIVLRADDGTSVAVGPLSWLSDRRIAFAPRKPLKSNSR
YEIMVPAGIRSTTGERSAHPLTSGFDTAPVTPPRGLPNLDGASCFINTALQLAVHSSALD
DILSNEAVPPAVRTLLEDYDAASADALDAQLAAAVAALRAMPEVTDSGAGRTLEVMHALR
MPLYDASSANNATNNADAIRHAPPNTKAFFLNSYPPLSYADLPNHDRLVAFDYSTGGHYV
AYVKRDGIWYRIDDAQVSAVNEQDLLALPAFNPDGSVSIEIAIYR
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaacgctcgacgtccggcgttcggcctgattgcgtcgcacgcgtcacgccgccgggcc
gtcgaatccgtgcgcgcccactttccgttcatgttcaccctctgtcttgcgatgaaaccc
acttcgaaccactccgacccttccggtgcgccgtcgtcagcgcggcgcgccgcatccgat
tcgtcccgcctcgtccgcggcatgcgctcgccccaacgcggcggcgcggcactggcgctg
gccgtcgcctcgctcgccggatgcgggggcggcgattcgggcgaacccgctccacgcgaa
ttcgcgcccccgacagtgcaactcgcctacccgacgcaaccgaactcgcccgtcgcacca
gcgcccaccgcgcacgtatcgagcggacacacgcctccggccacggcgcccgccgcgatg
cccaccgcttcacccaccgcgacggctgccgcttcgccctccgcgccatccactgcgacg
cccaacgccccgcccgccgctccgctggccgtcgtcgccacccgcgtcccgccgacgcac
gcggcgttgcgccgcccgacgatcgaactcgaattcgatcgcgcgatcgagccgggttca
gtcccacacatcgtgctgcgcgccgacgatggcacgagcgtcgccgtcggcccgttgtcg
tggctgagcgatcgccggatcgcgttcgcgccgcgcaagccgctcaagtcgaacagccgc
tacgaaatcatggtgcccgccggcatcaggagcaccacgggcgaacggtcggcccatccg
ctaacgagcggcttcgataccgcgcccgtcacgccgccgcgcggcctgcccaatctcgac
ggcgcctcgtgcttcatcaacacggcgctgcaattggcggttcactcgtcggcgctcgac
gacattctgtcgaacgaagccgtcccgcccgccgtccgcacgctgctcgaagactacgac
gccgcatcggctgacgcgctcgacgcgcagttggccgccgcggtcgccgcgctgcgcgcc
atgccggaggtcacggacagtggggcgggacgaacgctggaagtgatgcacgcgttgcgg
atgccgctatacgacgcgagcagcgcgaacaacgcaacgaacaacgccgacgccatacgt
catgcgccgcccaacaccaaggcgttctttctgaactcctatccaccgctttcctacgcg
gatctgccgaaccacgaccggctcgtcgcgttcgactacagcacgggcggtcactatgtc
gcttatgtgaagcgggatggaatctggtatcgaatcgacgatgcccaggtcagcgccgtc
aacgaacaggacttgcttgccctgccggcgttcaaccccgacggcagcgtgtcgatcgaa
atcgcgatctatcgatga

DBGET integrated database retrieval system