KEGG   Burkholderia pseudomallei 668: BURPS668_A2208Help
Entry
BURPS668_A2208    CDS       T00481                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bpd  Burkholderia pseudomallei 668
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BURPS668_A2208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ABN87540
UniProt: A3NLI0
Position
II:2138431..2140017
Genome map
AA seq 528 aa AA seqDB search
MNPLLSAAASEELGRTRHLGVALLVALLAAGVAYVFVHLLADLAPVGPRSAFPYLLLGVA
LAIALGFEFVNGFHDTANAVATVIYTHSLTPNVAVIWSGLWNFLGVMASTGAVAFGILQL
LPVELILQVGHGAGFAMVFALLIAAIAWNLATWYFGLPSSSSHTLIGSIIGVGLANQLMH
GPSGTSGVDWAQAAGVGQSLLLSPLVGFLCAALLLAALKALVRVPALYREPQTNEPPPFW
VRCLLILTCTGVSFAHGSNDGQKGMGLIMLILIGTVPTAYALNKAVTPGETQTFIAVAHR
ASETLARYAGAAQPSPNPRADVEAYVQSRRLSDATLPAVRRLSDALAAEVGATGSIAKVP
EGQADNVRNTMYLVSEALRLMEKTGRPAFSPADRLALDDYRRQLDHATKFIPTWVKVAVA
IALGLGTMVGWRRIVVTVGEKIGKQHLTYGQGASAEVVAMLTIGAADAYGLPVSTTHVLS
SGVAGTMAANGSGLQWSTVRSLVLAWVLTLPASIVLAGALYWAFHALT
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaatccccttctgtccgccgcggcgagcgaagagctcggtcgcacccggcatctgggc
gtcgcgctgctcgtcgccctcctcgccgccggcgtcgcgtacgtgttcgttcacctgctc
gcggatctcgcgcccgtcggcccacgctcggcgtttccgtatctgctgctcggcgtcgcg
ctcgcgatcgcgctcggcttcgagttcgtcaacggcttccacgacaccgcgaacgccgtg
gcgaccgtgatctacacgcattcgctgacgccgaacgtcgcggtcatctggtcgggcctc
tggaattttctcggcgtgatggcgtcgacgggcgcggtcgcgttcggcatcctgcaactg
ctgcccgtcgagctgatcctgcaagtcggccacggcgcgggcttcgcgatggtgttcgcg
ctgctgatcgcggcgatcgcgtggaatctcgcgacctggtacttcggcctgccttcgtcg
agctcgcacacgctgatcggctcgatcatcggcgtcgggctcgcgaatcagctgatgcac
gggccgtccggcacgagcggcgtcgattgggcacaggcggcgggcgtcggccaatcgctg
ctgctctcgccgctcgtcggcttcctgtgcgcggccctgctgctcgccgcgctgaaggcg
ctcgtgcgcgtgcccgcgctctaccgcgagccgcagacgaacgagccgccgccgttctgg
gtccgctgcctgctgatcctgacctgcaccggcgtgtcgttcgcgcacggctcgaacgac
gggcagaaaggcatggggctcatcatgctgatcctgatcggcaccgtgccgaccgcatac
gcgctcaacaaggcggtcacgcccggcgagacgcaaacgttcatcgccgtcgcacaccgc
gcgtccgaaacgctcgcccgctacgcgggcgccgcgcagccgtcgccgaacccgcgcgcc
gatgtcgaggcttacgtgcagtcgcgccgcctgagcgacgcgacgctgcccgcggttcgc
cggttgtcggacgcgctcgcggccgaagtcggcgcgacgggctcgatcgcgaaagtgccc
gaggggcaggcggacaacgtgcgcaacacgatgtatctggtgtccgaagccctgcgcctg
atggagaaaaccggccggccggcgttctcgccggcggatcgcctcgcgctcgacgactac
cgcaggcagctcgaccacgcgaccaaattcattccaacctgggtgaaggtcgcggtggcg
atcgcgctcggcctcggcacgatggtcggctggcggcgcatcgtcgtgaccgtcggcgag
aagatcggcaagcagcatctgacctacgggcaaggcgcgtcggcggaagtcgtcgcgatg
ctcacgatcggcgcggccgatgcgtacgggctgccggtgtcgacgacgcacgtgctgtct
tccggcgtcgcgggcacgatggccgcgaacggctccgggctgcaatggagcacggtgcgc
agcctcgtgctcgcgtgggtgttgacgctgcccgcgtcgatcgtgctcgcgggcgcgctc
tattgggctttccacgcgctgacctga

DBGET integrated database retrieval system