KEGG   Burkholderia pseudomallei 668: BURPS668_A2471Help
Entry
BURPS668_A2471    CDS       T00481                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00020  Citrate cycle (TCA cycle)
bpd00190  Oxidative phosphorylation
bpd00650  Butanoate metabolism
bpd01100  Metabolic pathways
bpd01110  Biosynthesis of secondary metabolites
bpd01120  Microbial metabolism in diverse environments
bpd01130  Biosynthesis of antibiotics
bpd01200  Carbon metabolism
Module
bpd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bpd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BURPS668_A2471 (sdhD)
   00650 Butanoate metabolism
    BURPS668_A2471 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BURPS668_A2471 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABN87141
UniProt: A3NM94
Position
II:complement(2388403..2388771)
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRVTASVMAIYTVILLVWLFIARDFSYEGWASIFA
TQWMKLATFVTLLSLFYHAWVGVRDIWMDYIKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgaataaccgtatcggctcgaagcgcctcgtcgtcggcgcacactatggtctg
cgcgactggctggcgcagcgcgtcaccgcgagcgtgatggcgatctacaccgtcatcctg
ctcgtctggctcttcatcgcgcgcgatttctcgtacgagggctgggcgtcgatcttcgcg
acgcaatggatgaagctcgcgaccttcgtcacgctgctttcgctcttctatcacgcatgg
gtcggcgtgcgcgacatctggatggactacatcaagcccgtcggtgtgcgcctgctgctg
caatcgctgacgatcgtctggctgctcgcgtgcgcgggctacgctgcgcagattctctgg
agagtttaa

DBGET integrated database retrieval system