KEGG   Burkholderia pseudomallei 668: BURPS668_A2953Help
Entry
BURPS668_A2953    CDS       T00481                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BURPS668_A2953
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpd02044]
    BURPS668_A2953
Secretion system [BR:bpd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS668_A2953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Gp5_C DUF2345
Motif
Other DBs
NCBI-ProteinID: ABN86493
UniProt: A3NNM3
Position
II:complement(2802588..2804792)
Genome map
AA seq 734 aa AA seqDB search
MTRVFTLDSLHGDDLKFHRLYGEEALGRMFDFRIEALADNHSLSLKELLGKPVTVRIRQQ
DESERHLNGIVARAALVGRRAERHYGYQLIVRPWLWLATRRSDCRIFQNKTVPEIVQDVL
GTYGFPIENHLTDTYAPRDYCVQYNETDAAFVSRLMEFEGIYYYFKHAAQTHTLMLCDAM
ASHVALPGCEHIPFIARDRTAIADEEHIDSWLPAQEVSIGKHETSDYDYTKPRADLSAQK
IDPRGHDHDGFASFEWPGGYRDDEPGAHYSRVRLEEQQAEHERALARTDVRGIAPGYLFT
LEHCPRADQNREYLIVRCQYRFQENAYATDSGNEAVVHESQTLVQPSSLPYRSPRATPRP
RTNGPQTATVVGPKGEEIWTDQYGRVKLQFRWDRYGQSDQNSSCWVRVSSPWAGGGFGGV
QIPRIGDEVVVDFLNGDPDQPIVTGRVYNGEKMPPWGLPGSATQSGLLSRSSPGGTAEHS
NAFRFEDKKGAEQLWMHAERNFDAETEQDHTLSVGHDHSHSVGNNEMMSVANDRQRSVGQ
NETVNIGKHRVAQIGGNETHGVAGNRTRQVGQNEAVTIGANREATIGGNHVETVAKDKTE
TIGQGKTLNVTQHYQTTSKSMKTAVAEHHAEEIGSRTSTIEKAHELNVGGSQSVNVGASH
TMSVKNNVHVGAGDQISLVCGDASITLKKDGTIAINGVTVESSASGSHSVRGKTVTSSAT
GEHTVEGTILKLNP
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcgtgttcacactcgacagcctgcacggcgacgacctgaagttccaccggctc
tacggcgaggaagcgctcgggcggatgttcgacttccggatcgaagcgctcgccgacaat
cacagcctgtcgctgaaggaactgctcggcaagccggtgacggtgcgcatccggcagcag
gacgaatcggagcgccatctgaacgggatcgtcgcgcgcgccgcgctggtcgggcggcgc
gcggagcggcattacggctatcaactgatcgtgcggccgtggctgtggctcgcgacgcgc
cgctccgattgccggatcttccagaacaagacggtgccggagatcgtgcaggacgtgctc
ggcacgtacggctttccgatcgaaaaccatctgaccgacacgtacgcgccgcgcgactac
tgcgtgcagtacaacgagaccgacgcggcgttcgtgtcgcggctgatggagttcgaaggg
atctactactacttcaagcacgccgcgcaaacgcacacgctgatgctgtgcgacgcgatg
gcgtcgcacgtcgcgctgccgggctgcgagcacattccgttcatcgcgcgcgaccgcacc
gcgatcgccgacgaagagcacatcgacagctggctgcccgcgcaggaagtgagcatcggc
aagcacgagacgagcgactacgactacacgaagccgcgcgcggatctgtccgcgcagaag
atcgatccgcgcggccacgaccatgacggcttcgcgtcgttcgaatggcccggcggctat
cgcgacgatgaaccgggcgcgcattacagccgcgtgcggctcgaagagcagcaggcggag
cacgaacgcgcgctcgcgcgcaccgacgtgcgcggcatcgcacccggctatctgttcacg
ctcgaacactgcccgcgcgccgaccagaaccgcgaatacctgatcgtgcgctgccagtat
cggtttcaggagaacgcgtacgcgaccgatagcggcaacgaggcggtcgtgcacgaatcg
cagacactcgtgcagccttcgagcctgccgtatcgctcgccgcgcgcgacgccgcggccg
cgcacgaacggcccgcagacggcgaccgtcgtcggcccgaagggcgaggaaatctggacg
gaccagtacgggcgcgtgaagctgcaatttcgctgggaccgctacgggcagagcgaccag
aactcgtcgtgctgggtgcgcgtgtcgagcccgtgggcgggcggcggcttcggcggcgtg
cagatcccgcgcatcggcgatgaggtggtggtcgatttcctgaacggcgaccccgatcag
ccgatcgtgacggggcgcgtgtacaacggcgagaagatgccgccatgggggctgcccggc
agcgcgacgcaaagcgggctgctgtcgcgctcgtcgccgggcggcacggccgagcattcg
aacgcgtttcgcttcgaggacaagaagggcgcggagcagctgtggatgcatgcggagcgc
aacttcgacgcggaaaccgagcaggaccacacgctgtcggtgggccacgatcactcgcat
tcggtcggcaacaacgagatgatgagcgtcgcgaacgaccggcaaaggagcgtcgggcag
aacgagacggtgaacatcgggaaacatcgcgtcgcgcagatcggcgggaacgagacgcat
ggcgtcgcgggaaaccgcacgcggcaggtcggacagaacgaggccgtgacgatcggcgcg
aatcgcgaggcgacgatcggcggcaatcacgtggagacggtcgcgaaagacaagaccgaa
acgatcgggcagggcaagacgctgaatgtcactcagcattatcagacgacttcgaagagc
atgaagaccgctgtcgccgaacatcacgccgaggagatcggctcgcgaacgtcgacgatc
gagaaagcgcacgagctcaacgttggcggttctcaatcggtgaacgttggcgcgagccac
acgatgagcgtgaagaacaacgtacatgtcggcgcgggcgatcagatctcgctcgtttgc
ggcgatgcgagcatcacgctgaagaaggacggcacgatcgcgatcaacggcgtcacggtg
gaatcgagcgccagcggaagccatagcgtgcgcggcaagacagtgacgtcgtcggcgacg
ggcgagcacacggtggaaggcacgatactgaaactgaacccctga

DBGET integrated database retrieval system