KEGG   Burkholderia pseudomallei 668: BURPS668_A2967Help
Entry
BURPS668_A2967    CDS       T00481                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
bpd  Burkholderia pseudomallei 668
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpd02044]
    BURPS668_A2967
Secretion system [BR:bpd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS668_A2967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: ABN87076
UniProt: A3NNN7
Position
II:complement(2823941..2825344)
Genome map
AA seq 467 aa AA seqDB search
MNEPVLSATPAAALRQRVIWTEGMFLRPQHFQQLERHWERYVGMRCLPLQGFYWGYDELQ
IDRELLALGKVALLAATGVMRDGTPFDLSHPDDRPEPLDVPADAKDQLVVLALPLWRGGA
QEVSFGAGGNGEGHGGDGNAHAGFARYVVREYEVADANEVALGPALLQTGRLNVRLMLES
ELTGDWQALGVARVVERRTDGRLLVDDGYIPPRLVAQRDPVLLRHTRELHGLLTQRSEAL
GERLSEPGRGGVSEVADFLLLQLVNRYLALTWHAQQDVAAHPETLFCDWLKLACDLSTFT
AAGRRPQSLAVYRHDDLRASFGELMAELRRSLSTVLEQNAIQIELRDVGNGMKVATIADP
ALRDTAGFVLAVRADVPADSLRARFPAQAKLGPVERIRDLVQLQLPGIAMRQLPVAPRQI
PYHAGHTYFEIDKGGEMWKQLERSGGLAFHFAGEFPGLSMEFWAIRG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagccggtattgtccgcgacccccgctgcggcgttgcgccagcgcgtgatctgg
accgagggcatgttcctgcggccgcagcatttccagcagctcgagcggcactgggagcgc
tacgtcggcatgcgctgcctgccgctgcaaggcttctactggggctacgacgagttgcag
atcgatcgcgagctgctcgcgctcggcaaggtcgcgttgctcgccgcgaccggcgtgatg
cgcgacggcacgccgttcgacctgtcgcatccggacgaccggcccgagccgctcgacgtg
cccgccgacgcgaaggatcagctcgtcgtgctcgcgctgccgctgtggcgcggcggcgcg
caggaggtgtcgttcggcgcgggcggcaacggcgaaggccacggcggcgacggcaacgcg
cacgcgggcttcgcgcgctacgtcgtgcgcgaatacgaagtcgccgacgcgaacgaggtc
gcgctcggccccgcgctattgcagaccggccgcctgaacgtgcgcctgatgctcgaatcc
gaattgacgggcgactggcaggcgctcggcgtcgcgcgcgtcgtcgagcggcgcaccgat
gggcggctgctcgtcgacgacggctacattccgccgcggctcgtcgcgcagcgcgatccg
gtgctgctgcgccacacgcgcgagctgcacgggctgctcacgcaacgcagcgaggcgctc
ggcgagcgcctgtcggagccggggcgcggcggcgtgtccgaagtcgccgatttcctgctg
ctgcaactcgtcaaccgctatctggcgctcacgtggcacgcgcagcaggatgtcgccgcg
cacccggagacgctgttctgcgattggctgaagctcgcgtgcgacctgagcacgttcacc
gcggccggccgccggccgcagtcgctcgcggtctaccggcacgacgatctgcgcgcgagc
ttcggcgagctgatggccgagctgcgccgctcattgtcgacggtgctcgagcagaacgcg
atccagatcgagctgcgcgacgtgggcaacggcatgaaggtcgcgacgatcgccgatccg
gcgctgcgcgacaccgcgggcttcgtgctcgccgtgcgcgccgacgtgccggccgacagc
ctgcgcgcgcgctttcccgcgcaggcgaagctcgggcccgtcgagcgcattcgcgatctc
gtgcagttgcaactgccgggcatcgcgatgcggcagttgcccgtcgcgccgcggcagatt
ccgtatcacgcgggccacacgtacttcgagatcgacaagggcggcgagatgtggaaacag
ctcgaacgctcgggcggcctcgcatttcatttcgccggcgaattcccgggactctcgatg
gagttctgggcgattcgcgggtga

DBGET integrated database retrieval system