KEGG   Burkholderia pseudomallei 668: BURPS668_A2971
Entry
BURPS668_A2971    CDS       T00481                                 

Definition
(GenBank) FHA domain protein
  KO
K07169  FHA domain-containing protein
Organism
bpd  Burkholderia pseudomallei 668
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    BURPS668_A2971
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-ProteinID: ABN88257
UniProt: A3NNP1
Position
II:2826955..2828388
AA seq 477 aa
MQLTVIEHAGEPVGTDGRNAVVFHAPGGTIGRDSDNHLVLRDDTRQISRLQALLQVADDA
CLLKNLSSVSTIEVNRVPIGYAQAQRLNMGDIIRIGPYLLRAEPDDATIERTVEAATTAA
AAAPAASAAQAQAKGAGYKLWGLLHERFGLGKAQGAGEQSGARAAPSRHHDSPASAAPRD
LNQLSTDPLDLFAQPRGDPDARAGAAREGEGRAPPTVTQPDHAPEWTQHVRVQPAQSAPP
AASRPGAPAARSGDIPAAGDASDMPSRVRASPAPAPATPETLLQAFFEGAGLDTAAEQHH
WSAEQLFVAGQLLALFANGTVELLSSRSILKREVKADMTMLLDRENNPLKLLPDGSAVLR
QMFGLPLPGFMTPQSAVSDAFQDLHAHQIGMVAGMRAALMDLLTRFSPQRLRERDAAPHW
YEKRVPALYKARLWDRYATTHRDTLFAIEDDFASVFGKAFLSAYDAEVESYRGRCRR
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgcaactgaccgttatcgaacacgcgggcgagccggtcggcaccgacggccgcaacgcc
gtcgtgtttcatgcgccgggcggcacgatcggccgggacagcgacaatcacctcgtgctg
cgcgacgacacccggcagatctcgcgcctgcaggcgctgctgcaggtggccgacgacgcg
tgcctgctgaagaacctgagcagcgtatcgacgatcgaagtgaaccgcgtgccgatcggc
tacgcgcaggcgcagcgcctgaacatgggcgacatcatccgaatcggcccttacctgctg
cgcgcggagcccgacgacgcgacgatcgagcgaaccgtcgaagccgccaccacggcggcc
gcggcggcgccggcggcgtccgccgcgcaggctcaggcgaagggggcgggctacaaactg
tggggcctgctgcacgagcgcttcgggctcggcaaggcacagggcgcgggcgagcagtcc
ggcgcgcgcgccgcgccgtcgcgccaccacgattcgccggcgtccgctgcgccgcgcgac
ctgaatcagctgtcgaccgatccgctcgacctgttcgcgcagccgcgcggcgatccggat
gcgcgagccggcgctgcgcgcgaaggcgaaggccgcgcgccgcccaccgtcacgcaaccg
gatcacgcgcccgagtggacgcaacacgtccgcgtgcagccggcgcaatccgcgccgccc
gccgcctctcgccccggcgcgcccgccgcgcgttcgggcgatatccccgcagcaggcgat
gcgagcgacatgccgtcgcgcgtgcgcgcgtcgccggcccccgcgccggcgacacccgag
acattgctgcaggcgttcttcgaaggcgcggggctcgacaccgccgccgagcagcatcac
tggtccgccgagcagttgttcgtcgcggggcagctgctcgcgctgttcgccaacggcacg
gtcgagctgctgtcgtcacgcagcatcctgaagcgcgaagtgaaggccgacatgacgatg
ctgctcgaccgcgagaacaatccgctgaagctgctgccggacggcagcgcggtgctgcgc
cagatgttcgggctgccgctgccgggcttcatgacgccgcaaagcgccgtgtccgacgcg
ttccaggatctgcacgcgcaccagatcggcatggtggccggcatgcgcgccgcgctgatg
gatctgctcacgcgcttctcgccgcagcgcctgcgcgagcgcgacgccgcgccccactgg
tacgagaagcgcgtgccggcgctgtacaaggcgcgcctctgggaccgctatgcaaccacg
catcgcgacacgctgttcgcgatcgaggacgatttcgcctccgtgttcggcaaggcgttc
ctcagcgcctacgacgcggaagtcgagagctatcgcggacgctgccgccggtga

DBGET integrated database retrieval system