KEGG   Bordetella pseudohinzii: BBN53_05065Help
Entry
BBN53_05065       CDS       T04945                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpdz  Bordetella pseudohinzii
Pathway
bpdz00071  Fatty acid degradation
bpdz00072  Synthesis and degradation of ketone bodies
bpdz00280  Valine, leucine and isoleucine degradation
bpdz00310  Lysine degradation
bpdz00362  Benzoate degradation
bpdz00380  Tryptophan metabolism
bpdz00620  Pyruvate metabolism
bpdz00630  Glyoxylate and dicarboxylate metabolism
bpdz00640  Propanoate metabolism
bpdz00650  Butanoate metabolism
bpdz00900  Terpenoid backbone biosynthesis
bpdz01100  Metabolic pathways
bpdz01110  Biosynthesis of secondary metabolites
bpdz01120  Microbial metabolism in diverse environments
bpdz01130  Biosynthesis of antibiotics
bpdz01200  Carbon metabolism
bpdz01212  Fatty acid metabolism
bpdz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpdz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBN53_05065
   00630 Glyoxylate and dicarboxylate metabolism
    BBN53_05065
   00640 Propanoate metabolism
    BBN53_05065
   00650 Butanoate metabolism
    BBN53_05065
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BBN53_05065
   00072 Synthesis and degradation of ketone bodies
    BBN53_05065
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBN53_05065
   00310 Lysine degradation
    BBN53_05065
   00380 Tryptophan metabolism
    BBN53_05065
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BBN53_05065
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BBN53_05065
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BBN53_05065
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpdz04147]
    BBN53_05065
Enzymes [BR:bpdz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BBN53_05065
Exosome [BR:bpdz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBN53_05065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANY15312
UniProt: A0A0J6C8K5
Position
1125161..1126342
Genome map
AA seq 393 aa AA seqDB search
MKEVLVVAGARSAIGDFGGALKDVAPCDLGATVIREALNRAGVKGDEVGHVAVGNVICTE
PRDMYLSRVAAISAGISKETPAFNVNRLCGSGLQAVVSAAQGIMLGDTEIAVAAGAESMS
RAPYIAQGQRWGARMGDSVMIDMMTGALSDPFGRMHMGVTAENVAARFGISRADQDALAA
ESHRRASAAIAAGYFKDQIVPITIKTRKGDVVFEVDEHVRGDVTAEGLSKLKPVFQKENG
TVTAGNASGLNDGAGALVLMESSVAARRGAKPLARLVAYAHSGVDPEIMGIGPVPATQAV
LKRAGLTVDQLDVIEANEAFAAQACAVTRELKLDPAKVNPNGSGISLGHPIGATGAIITV
KALYELQRVKGRYALVTMCIGGGQGIAAVFERV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtattggtcgtcgcgggcgcccgcagcgcgataggcgattttggcggcgcc
ctgaaggatgtggcgccctgcgacctgggcgccaccgtcatccgcgaggcgctgaaccgc
gccggcgtcaagggcgacgaagtcggacatgtcgcggtgggcaacgtcatttgcaccgag
ccgcgcgacatgtatctgtcccgcgtggccgccatcagcgccggcatcagcaaggaaacc
cccgctttcaacgtcaaccggctgtgcggctcgggcttgcaggcggtggtgtcggccgcc
cagggcatcatgctgggcgacaccgagatcgccgtggcggccggcgccgagagcatgagc
cgcgcgccgtatatcgcgcagggccagcgctggggcgcgcgcatgggcgacagcgtcatg
atcgacatgatgaccggcgcgctgtcggatcccttcggccgcatgcacatgggcgtgacg
gcggaaaatgtggcggcgcgtttcggcatcagccgcgccgaccaggacgccctggccgcc
gagtcgcatcgccgcgccagcgccgcgatcgccgccggctatttcaaggatcagatcgtc
ccgatcaccatcaagacccgcaagggcgatgtggtcttcgaggtggacgagcatgtgcgc
ggcgatgtgaccgccgaaggcctgtccaagctcaagccggtcttccagaaagaaaacggc
acggtcaccgcgggcaatgcctcgggcctgaacgacggcgcgggcgcgctcgtcctcatg
gaaagcagcgtggccgcccgccgcggcgccaagcccctggcccgcctggtggcctacgcc
cattcgggcgtggacccggaaatcatgggtatcgggcccgtgccggcgacgcaggccgtg
ctcaagcgcgccggcctgacggtcgaccagctcgatgtcatcgaggccaacgaggccttc
gccgcgcaggcttgcgccgtgacgcgcgaactcaagctggacccggccaaggtcaatccc
aatggcagcggcatcagcctgggccatcccatcggcgcgaccggcgccatcattaccgtc
aaggccttgtacgagctgcagcgcgtcaagggccgctatgcgctggtgaccatgtgcatt
ggcggcgggcagggtatcgcggcggtgttcgagcgcgtctga

DBGET integrated database retrieval system