KEGG   Bordetella pseudohinzii: BBN53_05775Help
Entry
BBN53_05775       CDS       T04945                                 

Definition
(GenBank) phospholipase C, phosphocholine-specific
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bpdz  Bordetella pseudohinzii
Pathway
bpdz00562  Inositol phosphate metabolism
bpdz00564  Glycerophospholipid metabolism
bpdz01100  Metabolic pathways
bpdz01110  Biosynthesis of secondary metabolites
bpdz02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bpdz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BBN53_05775
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBN53_05775
   00565 Ether lipid metabolism
    BBN53_05775
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBN53_05775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bpdz02042]
    BBN53_05775
Enzymes [BR:bpdz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     BBN53_05775
Bacterial toxins [BR:bpdz02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   BBN53_05775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756
Motif
Other DBs
NCBI-ProteinID: ANY15444
UniProt: A0A0J6C887
Position
complement(1280551..1282650)
Genome map
AA seq 699 aa AA seqDB search
MKTRRDFLRNTAMAGTALGLFPGVIRRALAIEPRRRSGTIEDVEHIVVFMQENRSFDHYF
GTLAGVRGFGDRFPIPVPDQAGRRDATVWNQLNDEGAPRVLRPFRLDTERIFELMRVKGT
PHTWSNAQDAWDMGRMHRWPVFKRDHSMAYFAQGDLPFQFALARAFTVCDAYHCSFTGGT
NTNRLFAWSGSNDGLGRGHGPALGNTYNKLSGGDPARAYTWTTYPERLERAGISWRIYQD
MKDNYSLNPTAGFKAYRDAHQGLPGALAALKREALSTHSLESLEADVRAGRLPQVSWICA
TKAGSEHPSPSSPAQGADYTARVLHALTVNPDVWSKTVLLLMFDENDGFFDHMPPPAPPS
RDPGQAHAQLAGASTVDTTGEYHEIVAGAEEDDFPRLRGSPYGLGPRVPMYVISPWTRGG
WVNSEVFDHTSILRFIERRFGVAETNISAWRRAVCGDLTSIFDFRAEPAPPPAGLPPTET
LARRAAGLHGTTVPPTPDDPPPASQEAGTRPSRPLPYALHVQERLDARGIELEFINDGRA
GAVFHVYDRLHMEGPPRRYTVEAGKRLRDVWTQGRHDLWILGPNGYHWRYAGRMAVEIRL
AYLPEAGMLRLTAVNRDAQPRRLRLAGQTYGDLARQTLRLAPGEEVSLQWNVAAAGRWYD
VEVDSPDDADFYRRLAGRMENGQPSVSDPAMGGPLRLKV
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgacgtgatttcctgcgcaatacggccatggccggcaccgccctgggcctg
ttccccggcgtcatccgccgggcattggccatcgagccgcgccgccgcagcggcactatc
gaggacgtcgaacatatcgtcgtcttcatgcaggagaaccgctccttcgatcattatttc
ggcaccctggccggcgtgcgcggctttggcgaccgcttccccatccccgtgcccgaccag
gcaggccggcgcgatgccacggtctggaatcagctcaacgatgaaggcgcgccgcgcgtc
ctgaggcccttccggctggataccgagcgcatcttcgagctgatgcgcgtcaagggcacg
ccccatacctggtccaatgcccaggacgcctgggacatggggcgcatgcaccgctggccg
gtcttcaagcgcgatcattccatggcctacttcgcgcagggcgacctgcccttccagttc
gccctggcccgggccttcacggtctgcgacgcctatcactgttcgttcacgggcggcacc
aacaccaaccggctcttcgcctggagcggcagcaacgacggcctgggccgcggacatggc
ccggccctgggcaatacctataacaagctgtcgggcggcgatccggcgcgcgcctacacc
tggaccacctaccccgagcgcctggagcgcgccggcatcagctggcgcatctaccaggac
atgaaggacaactattcgctcaatccgaccgcgggcttcaaggcctaccgcgacgcccat
cagggtctgcccggcgccctggccgccctcaagcgcgaagccctgagcacccatagcctg
gaaagcctggaggccgatgtgcgcgccggccggctgccgcaagtctcctggatctgcgcc
accaaggcaggctcggaacatcccagcccgtcgagcccggcccagggcgccgactacacc
gcgcgcgtgctgcatgcgctgaccgtcaatcccgacgtctggagcaagacggtgctgctg
ctcatgttcgacgagaacgacggcttttttgaccatatgccgccgcccgcgccgccctcg
cgggatccaggccaggcgcatgcccagctggcgggcgcctccacggtggacaccacgggc
gaatatcacgagatcgtcgccggcgcggaggaggatgattttccgcgactgcgcggcagc
ccctatggcctggggccgcgcgtgcccatgtatgtcatctcgccctggacgcggggaggc
tgggtcaactcggaggtcttcgaccacacctccatcctgcgcttcatcgagcggcgcttc
ggcgtggcggagacgaatatctcggcctggcgccgcgccgtctgcggcgacctgacttcc
atcttcgatttccgcgccgagccggcaccgccccccgccgggctgccgcccaccgaaacc
ctggcccggcgcgcggccggcctgcacgggaccaccgtgccgccgacgccggacgatccc
cccccggccagccaggaggccggcacgcggccttcccgccccctgccctatgccctgcat
gtgcaggagcgcctggacgcccgcggcatcgaactggaattcatcaacgacggccgcgcc
ggggctgtcttccatgtctatgaccgcctgcatatggagggcccgccgcgccgctacacg
gtggaggcgggcaagcgcctgcgcgacgtctggacgcaagggcgccacgatctctggata
ctgggccccaatggctatcactggcgctacgccggccggatggccgtcgagatccggctg
gcctatctgcccgaggccgggatgctgcggcttaccgccgtcaaccgcgatgcccagccg
cggcgcctgcggctggccggccagacctatggcgacctggcgcggcagacgctgcgcctg
gcccccggcgaagaggtctccctgcaatggaatgtggcggcggcgggccgctggtacgac
gtggaggtcgacagcccggatgacgcggacttttatcgccggctggccggccgcatggaa
aacggccagccgtccgtgtcggatcccgccatgggcgggccgttgcgcctgaaggtgtaa

DBGET integrated database retrieval system