KEGG   Bordetella pseudohinzii: BBN53_06670Help
Entry
BBN53_06670       CDS       T04945                                 

Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
bpdz  Bordetella pseudohinzii
Pathway
bpdz00540  Lipopolysaccharide biosynthesis
bpdz01100  Metabolic pathways
Module
bpdz_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:bpdz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BBN53_06670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bpdz01005]
    BBN53_06670
Enzymes [BR:bpdz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     BBN53_06670
Lipopolysaccharide biosynthesis proteins [BR:bpdz01005]
 Unusual sugar
  BBN53_06670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD NAD_binding_4 Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: ANY15613
UniProt: A0A0J6C7K0
Position
1479531..1480520
Genome map
AA seq 329 aa AA seqDB search
MIIVTGAAGFIGSNLVRGLNRRGIYDIIAVDDLTQGDKFLNLVDCKIADYMHHEDVRELL
RAGKLPRLRAVLHQGACSDTTERNGRYMMDNNYRVTLEWFEYCQAQRVPFLYASSAAVYG
ASTVYVEDPANEGPLNVYGYSKLLFDQVLRTRLDKLTAQVVGLRYFNVYGPHEQHKGRMA
SVAFHNMNQFLAEGHVRLFAGWDGYPDGGQSRDFISVQDVVDVNLHFLDHPQISGIFNCG
TGRAQPFNDVAAAVVNSLRAERGEAALPLDKLVSEGLIRYIPFPDDLKGRYQSFTQANVD
NLRAAGFTAPMRDVQTGVSEYVSYWRARK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgatcattgtcactggcgcggccggtttcatcggcagcaacctggtgcgcgggctcaat
cgccgcggcatctacgacatcatcgccgtcgacgacctgacccagggcgataaattcctc
aatctcgtcgactgcaagatcgccgactacatgcatcacgaggatgtgcgcgaattgctg
cgcgccggcaagctgccgcgcctgcgggccgtgctgcatcaaggcgcctgttcggacacc
accgagcgcaatggccgctacatgatggacaacaactaccgcgtcacgctggagtggttc
gagtattgccaggcgcagcgcgtgccttttttgtacgcctcctcggccgccgtctacggc
gcctcgacggtctatgtcgaagacccggccaacgagggtccgctcaatgtctacggctat
tccaagctcttgttcgaccaggtcctgcgcacgcgcctggacaagctcacggcccaggtc
gtcgggctgcggtatttcaacgtctatggcccgcacgagcagcacaagggccgcatggcc
tcggtggcctttcacaacatgaaccagttcctggccgaagggcatgtgcgcctgttcgcg
ggctgggacggctatcccgatggcggccagagccgggatttcatttcggtccaggacgtg
gtggacgtcaatctgcattttctggatcacccgcagatctcgggcatcttcaattgcggc
accggacgcgcgcagcccttcaatgatgtggccgccgccgtggtgaacagcctgcgcgcc
gagcggggcgaggccgcgctgccgctggacaagctcgtgagcgaaggcctgatccgctac
attcccttccccgatgacctgaagggacgctaccagagcttcacccaggccaatgtggac
aatctgcgcgcagccggctttaccgcgcccatgcgcgatgtgcagaccggcgtgagcgaa
tacgtgagctattggcgcgcgcgcaaataa

DBGET integrated database retrieval system