KEGG   Bordetella pseudohinzii: BBN53_12745Help
Entry
BBN53_12745       CDS       T04945                                 

Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
bpdz  Bordetella pseudohinzii
Pathway
bpdz00860  Porphyrin and chlorophyll metabolism
bpdz01100  Metabolic pathways
bpdz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpdz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BBN53_12745
Enzymes [BR:bpdz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     BBN53_12745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C DUF743
Motif
Other DBs
NCBI-ProteinID: ANY16681
UniProt: A0A0J6ETL3
Position
complement(2805215..2806594)
Genome map
AA seq 459 aa AA seqDB search
MSSVHAPSRLSPDTLARLAKTGPRYTSYPTADRLHEGFGPAQWADALAARAGGEPLSLYV
HIPFCDSVCYYCACNKVVTRHHERAARYLDALSREMAMQAALLGRRTAVAQLHFGGGTPT
FLSDAELGRLMDDLRRHFDIQAGAEISIEVDPRTIDAQRLLNLARMGFNRLSFGVQDFDP
AVQQAVHRVQPYEAVRGLMQAARAVGFPSINVDLIHGLPRQTAASFARTIARVGELRPDR
IALYAYAHLPARFKPQRRILAEELPDPATRLALLGSAIDRLMDQGYAYIGMDHFALPEDS
LARARAEGRLHRNFQGYSTEPDRDLLALGVSAISQVGPVYSQNHKDLEAYYQAVEAGGFP
VERGLACSQEDVWRRRLIMDIMCRGRLDLRAAGGGADPEQVFAAELPQLRRLQAMGLLQL
ADGCLSVTEQGWFFVRAIAMVFDAYLRASATAERYSRIA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccgtgcatgcgccatcccgcttgtcgcccgataccctggcccgcctggccaag
accgggccccgctacacctcctatcccaccgccgaccgcctgcatgaagggtttgggccg
gcgcaatgggccgatgccctggcggccagggcaggcggcgagccgctgtcgctgtacgtg
catatcccattctgcgattcggtgtgctactactgcgcgtgcaacaaggtcgtgacgcgg
catcacgagcgcgccgcgcgctatctcgacgcgctgtcgcgcgagatggccatgcaagcg
gccctgctcgggcgcaggacggccgtggcgcagctgcatttcggcggcggcacgcccacc
ttcctgtccgatgccgaactggggcgcctgatggacgatctccggcgccatttcgatatc
caggccggggctgaaatctccatcgaggtcgaccctcgcaccatcgatgcgcagcgcctc
ttgaacctggcgcggatgggattcaaccggctgagttttggcgtgcaggatttcgatccg
gccgtgcagcaggcggtgcatcgcgtccagccctatgaggccgtgcgcgggctgatgcag
gccgcaagggcggtgggtttcccgtccatcaatgtggatctgatccatggcctgccccgg
cagacggcggcctcgttcgcgcgcaccatcgcccgggtgggcgagctgcgcccggatcgc
atcgccctgtatgcctatgcgcacctgccggcgcgcttcaagccgcagcggcgcattctt
gccgaagaactgcccgatccggccacgcgcctggccttgctgggctcggccatcgaccgc
ctgatggaccagggctatgcctatatcggcatggaccatttcgccctgccggaggacagc
ctggcgcgagcccgcgccgaggggcgcctgcaccggaatttccaggggtacagcaccgag
cccgaccgcgatctgctggccttgggcgtttcggccatcagccaggtgggaccggtatac
agccagaaccacaaggacctggaggcctattaccaggcggtggaggccgggggctttccg
gtggagcgcggcctggcctgcagccaggaggatgtgtggcgccggcggctcatcatggac
atcatgtgccgcgggcgcctggacctgcgcgccgccggcggcggcgccgatcccgagcag
gtgttcgccgcggaactgccgcagctgcgccgcctgcaggccatgggcctgctgcaactg
gccgacggttgcctttccgtgacggaacagggctggttcttcgtgcgcgcgatcgccatg
gtgttcgacgcctatctgcgcgcctcggccacggccgagcgctattcgcgcattgcctga

DBGET integrated database retrieval system