KEGG   Bordetella pseudohinzii: BBN53_13740Help
Entry
BBN53_13740       CDS       T04945                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bpdz  Bordetella pseudohinzii
Pathway
bpdz00970  Aminoacyl-tRNA biosynthesis
bpdz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpdz00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BBN53_13740
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bpdz03029]
    BBN53_13740
Enzymes [BR:bpdz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BBN53_13740
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BBN53_13740
Mitochondrial biogenesis [BR:bpdz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BBN53_13740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ANY16850
UniProt: A0A0J6C3E3
Position
complement(3028070..3029449)
Genome map
AA seq 459 aa AA seqDB search
MLHQQPFNVLRAAYRAGSLSPVAVTTSALDHAEQVDGKLNAFALIDRDRAIGLAHQSERR
WRDGSPLGLLDGMPMTIKEFAAVQGWPTRRGSVVTSDVPASSSAVFADRLLHAGAVLLGK
TRAPEFNWKGVTDSPGYGITRNPLDPALTPGGSSGGCSAVVAAGVVRASIGSDAGGSVRI
PAAFTGTVGLKPTFGRIPLAPPPSAFFNVVNAGPIAASVRELAEVMHVVSGPAPGDWTSV
GLKDVDFNAIPNAADLRVGLLQADRWKNSDAVVLQGMSEFERLLTGGGFKAQKADFDVEE
ASRVGAFFYKMGCRAAVSFVPEDRRAELDPALLKFVQTLPPLTADLIVEMQQKRDFLAGQ
LHQLFDDVDVLVLPTMPILPFEAGRNTPAGSEVDDWMSWNPFTPAFNLAQTPALSYPLWP
QGASMPMGVQFVAARGRDDLVLALAEWLEQRRPVRLMSS
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatcagcaaccgtttaatgtgctgcgggcggcatatcgggctgggtctctgtcg
cccgtggccgtcacgacatccgcacttgatcatgcagaacaggtcgacggcaagttgaac
gcgttcgcgctgattgatcgcgatcgagctattgggcttgcgcatcagtccgagcgtcgc
tggcgggacggttctcctctaggattgctcgatgggatgccgatgactatcaaggagttt
gccgccgtgcaggggtggcccactcggcgaggatccgttgtgacttccgacgttccggct
tcctcgagcgcggtgttcgctgatcggctgctgcatgctggcgcggtgctcttggggaag
actcgggcccccgagttcaattggaagggcgtgactgacagccccggctatggcatcacg
cgaaatccgttggatcctgcgttgactcccggtgggagtagtggggggtgctctgcggtc
gtcgccgcaggagtggtgcgagcgtcaattgggagcgatgctggcgggtctgtccgtatt
ccagcggcatttacaggaacggttgggctcaagccgacgtttggccgcatccctcttgcg
cctccgcccagcgcgttctttaacgtggtcaatgccggcccaatagcggcgagcgtccgc
gagctagccgaggtcatgcacgtcgtaagtggtccggcgcccggcgactggacctcggtt
gggctgaaagacgttgactttaatgccattccgaatgcggccgatctgcgagtcggcttg
cttcaggccgatcgatggaaaaacagtgatgcggttgtgctccaagggatgtcggagttc
gaacgcttgttgaccggtgggggattcaaggcgcagaaggcggacttcgatgtcgaagaa
gcgtctcgcgtaggtgcgttcttctacaagatgggttgcagggctgccgtctcgttcgtg
cctgaggatcgcagagctgagcttgatccggcactactaaagttcgtgcagacactgcct
ccgttgaccgccgatctgatcgttgagatgcagcagaagagggacttcttggccggccag
ctccatcaactattcgacgacgtcgacgtgctcgttcttccgacaatgccaattctgcct
ttcgaggcagggcggaacaccccagcaggatcggaggtcgacgactggatgtcctggaat
ccgtttacaccggcgttcaatctggcgcaaacgcctgcgctgtcctatccgctttggcct
caaggtgcttcgatgcctatgggcgttcagttcgttgcagcccgaggtcgcgatgacttg
gtcttagcactggctgaatggctggaacagcgtcgaccagttcgattgatgtctagctaa

DBGET integrated database retrieval system