KEGG   Bordetella pseudohinzii: BBN53_17525Help
Entry
BBN53_17525       CDS       T04945                                 

Definition
(GenBank) carnitine dehydratase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bpdz  Bordetella pseudohinzii
Pathway
bpdz00010  Glycolysis / Gluconeogenesis
bpdz00053  Ascorbate and aldarate metabolism
bpdz00071  Fatty acid degradation
bpdz00280  Valine, leucine and isoleucine degradation
bpdz00310  Lysine degradation
bpdz00330  Arginine and proline metabolism
bpdz00340  Histidine metabolism
bpdz00380  Tryptophan metabolism
bpdz00410  beta-Alanine metabolism
bpdz00561  Glycerolipid metabolism
bpdz00620  Pyruvate metabolism
bpdz00625  Chloroalkane and chloroalkene degradation
bpdz00903  Limonene and pinene degradation
bpdz01100  Metabolic pathways
bpdz01110  Biosynthesis of secondary metabolites
bpdz01120  Microbial metabolism in diverse environments
bpdz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpdz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBN53_17525
   00053 Ascorbate and aldarate metabolism
    BBN53_17525
   00620 Pyruvate metabolism
    BBN53_17525
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BBN53_17525
   00561 Glycerolipid metabolism
    BBN53_17525
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBN53_17525
   00310 Lysine degradation
    BBN53_17525
   00330 Arginine and proline metabolism
    BBN53_17525
   00340 Histidine metabolism
    BBN53_17525
   00380 Tryptophan metabolism
    BBN53_17525
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BBN53_17525
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BBN53_17525
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BBN53_17525
Enzymes [BR:bpdz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BBN53_17525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1487
Motif
Other DBs
NCBI-ProteinID: ANY17518
Position
complement(3792949..3794412)
Genome map
AA seq 487 aa AA seqDB search
MYIDGEFTHGENGAMLDSVDPVSGEVWARIPHGTAGDVSRAVEAAHRAFTQGEWPAYTPS
ARGALLRRIGDLVAEHADWLAYVEQRDNGKLIAELSMQMRYMANYYYYYGGLADKMEGSV
IPTDKSGVFNYTKYEPLGVVACITPWNSPLPLASMKIAPALAAGNTVVCKPSEFTSASLL
ELAKLFDLAGAPKGIFNVVTGLGAEVGDALISHPYVERIAFTGGPEAGRIINEKAARLMK
RVTLELGGKSPNIVFEDADLDQAVKGAIAGIFAASGQTCVAGSRLLVQDSIHDAFVEKLL
DIVGGARFGHPADPRTQIAPISTAPQLEKVKAYVDIALKDGARLVLGGRPASVPECPKGL
FFQPTIFVDVDNSMRIAQEEVFGPVLSIIRFKDEDDAVRIANDIQFGLAAGIWTQSITRA
FAMANRVRAGTVWVNNYRSTSVTSPFGGFKMSGVGRECGIAGMREYMEIKSVWISTETNI
PNPFVRR
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtatatcgatggcgagttcacgcatggggagaacggagcgatgctggattcggtcgat
ccggtcagcggggaggtctgggcgcgcattccgcatggcacggccggggatgtgtcgcgc
gccgtcgaggcggcgcatcgggcattcacgcaaggcgaatggccagcctacacgccaagc
gcgcgtggcgccctgttgcgccgcatcggcgatctggtggccgagcacgcggattggctc
gcctatgtcgagcagcgcgacaacggcaagctgatcgccgagctgtcgatgcagatgcgc
tacatggccaactactattactactatggcggcctagccgacaagatggaagggtcggtc
attccaaccgacaagtctggggtcttcaactacaccaagtacgaacccctgggcgtggtg
gcgtgcatcacgccctggaattcgccattgccgctggccagcatgaaaatcgccccggcc
ctggccgcgggcaataccgtggtgtgcaaaccatcggagttcacctccgcctcgctgctt
gagctggccaagctgtttgatctggcgggcgcgccgaaaggcattttcaatgtggtgacc
ggactgggcgccgaggtcggtgatgcgctgatcagccacccctatgtcgagcgtatcgcg
ttcacaggcgggcctgaggccggacgtatcatcaacgaaaaggccgcccgcctcatgaag
cgcgtgacgctggagctgggcggcaagtctcccaatatcgtgttcgaggacgccgacctg
gaccaagccgtcaagggggcgatcgccggtattttcgcggcttccggacagacctgcgtg
gccggttcgcgcctgctggtgcaggacagcatccatgatgccttcgtcgagaagctgctg
gacatcgtcggcggggcgcgctttggccatccggccgatccccgcacgcagatcgcgccg
atctcgacggcgccgcagctggaaaaggtcaaggcatatgtggatattgccttgaaagac
ggcgcgcgcctggtcttgggtggccgcccggcatcggtgcccgagtgtcccaagggcctg
ttcttccagccgaccattttcgtggacgtggacaacagcatgcgtatcgcgcaggaagaa
gtcttcggcccggtgttgtccatcatccgcttcaaggacgaagacgacgcggtgcgcata
gccaatgacatccagttcggattggccgcgggcatctggacgcaatcgatcacgcgcgcc
ttcgccatggccaatcgcgtccgcgccggcaccgtatgggtcaacaactatcgatccacc
agcgtgacctcacccttcggcggcttcaagatgagcggcgtgggccgcgaatgcgggatt
gccgggatgcgcgagtacatggagatcaagagtgtatggatctccactgaaacgaatatt
cccaaccccttcgtgcgccgttag

DBGET integrated database retrieval system