KEGG   Bordetella pertussis Tohama I: BP0032
Entry
BP0032            CDS       T00139                                 

Name
(GenBank) probable transporter
Organism
bpe  Bordetella pertussis Tohama I
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_3
Other DBs
NCBI-ProteinID: CAE40411
UniProt: Q7W0Q7
Position
complement(35573..36763)
AA seq 396 aa
MSDHDASFSLKDIAVPAFGPSILYGVSNGAILPVVALTARELGASLATSGLIVGLVGIGS
LVSNIPAAMFTSRHGERRSMVGAAALSVVALLLCIFAGTLWMLATGVFMVGMASSVFLLA
RQGYMIDAVPAYMRARALSTLAGTMRIGVFAGPFAGAALIHFMGLQGAYWVAAVAMTGAG
LIAWFAPDMAPPRRRGEAAVARPRLLDVARAHRQVYLTLGLGILLVSAVRASRQVVIPLW
ADHLGVNPATTSLIYGLVAAIDMSVFYPAGMLMDRRGRLWVAVPSTLLMGCALIGTSLTS
GVAGFVIVAMMLGMGNGIGSGIVMTLGADAAPASGRTEFLGLWRLMSDLGGSLGPVALSG
ITALVSLAAGVAAMGGVGLAAAAVFWHWLPRGQAPR
NT seq 1191 nt   +upstreamnt  +downstreamnt
gtgtccgaccacgacgcttcgttcagcctcaaagacattgccgttcccgccttcggcccc
tccatcctctatggcgtgagcaatggcgccatcctgcccgtggtggcgcttaccgcacgg
gaactgggcgcatcgctggctacctcgggcctgatcgtgggcctggtcggcatcggttcg
ctggtcagcaacatccccgccgcgatgttcacctcgcgccacggcgagcggcgctccatg
gtgggcgcggcggcgctcagcgtggtggcgctgctgctgtgcatcttcgccggcacgctg
tggatgctggcgaccggcgtgttcatggtcggcatggcgtcctcggtcttcctgctggcg
cggcagggctacatgatcgacgccgtgcccgcctacatgcgcgcgcgcgccctgtccacg
ctggccggcaccatgcgcatcggcgtgttcgccgggccgttcgccggcgcggcgctgatc
cacttcatgggcctgcagggcgcgtactgggtggcggccgtggccatgaccggggccggc
ctgattgcgtggttcgcgcccgacatggcgccgccgcggcgccgcggcgaggcggccgtc
gcccggccgcggctgctggacgtggcgcgcgcgcatcgccaggtatacctgacgctgggg
ctgggcatcctgctggtcagcgcggtgcgcgcgtcccggcaggtggtgatcccgctgtgg
gccgaccacctgggcgtcaacccggcgaccacctcgctcatttatggcctggtggcggcg
atcgacatgtcggtgttctatccggcaggcatgctgatggaccggcgcgggcggctgtgg
gtggcggtgccctcgacgctgctgatgggctgcgccctgatcggcacctcgctgaccagc
ggcgtggccggtttcgtgatcgtggcgatgatgctgggcatgggcaacggcattggctcg
ggcattgtcatgacgctgggcgccgacgcggcgcctgcgtccgggcgtaccgagttcctg
ggcctgtggcgcctgatgtccgacctgggcggcagcctggggccggtggcgctgtccggc
atcaccgcgctggtgtcgctggccgccggggtggcggccatgggcggggtgggcctggcc
gccgccgccgtgttctggcactggctgccgcgcggccaggcgccgcgctag

DBGET integrated database retrieval system