KEGG   Bordetella pertussis Tohama I: BP0214
Entry
BP0214            CDS       T00139                                 

Definition
(RefSeq) 7-cyano-7-deazaguanine synthase
  KO
K06920  7-cyano-7-deazaguanine synthase [EC:6.3.4.20]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe00790  Folate biosynthesis
bpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BP0214
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bpe03016]
    BP0214
Enzymes [BR:bpe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.20  7-cyano-7-deazaguanine synthase
     BP0214
Transfer RNA biogenesis [BR:bpe03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    BP0214
SSDB
Motif
Pfam: QueC Diphthami_syn_2
Other DBs
NCBI-GeneID: 2664734
NCBI-ProteinID: NP_879102
UniProt: Q7W0D1
Position
complement(219277..219996)
AA seq 239 aa
MQNHQRRALVLFSGGQDSTTCLAWALERYAHVETLGFDYGQRHRVELDARQVVLRELRAN
FPDWAQRLGDDHLLDLGILAQVGDTAMTSDREIEMQANGLPNTFVPGRNLLFLTLAAALG
YRRQLDVLVGGMCETDFSGYPDCRDDTIKSQQVTLGLGLGTRVTIETPLMWLDKAQTWEL
ADRLGGQALVDMVIEHSHTCYLGERGQRHDWGYGCGHCPACALRKNGWERWVAGAAHAD
NT seq 720 nt   +upstreamnt  +downstreamnt
atgcaaaaccatcaacgacgcgccctggtgctgttctcgggcggacaggattccaccact
tgcctggcctgggcgctggagcgctatgcccacgtcgagacgctgggtttcgactacggc
cagcggcatcgcgtcgagctggatgcccgccaggtcgtgctgcgcgaactgcgcgccaac
tttcccgactgggcccagcgcctgggcgacgatcatctgctcgacctgggcatcctggcg
caggtgggcgacaccgccatgaccagcgaccgcgagatcgagatgcaggccaacggcctg
cccaataccttcgtgcctggccgcaacctgctgttcctgacgctggccgcggcgctcggt
tatcgccgccagctcgacgtgctggtgggcggcatgtgcgaaaccgatttttccgggtac
ccggactgccgcgacgacaccatcaagtcgcagcaggtaacgctgggcctggggctgggt
acgcgggtcaccatcgagacgccgctgatgtggctggacaaggcccagacctgggagctg
gccgaccggctgggcgggcaggcgctggtcgacatggtgatcgagcacagccatacctgc
tacctgggcgagcgcggccagcgccacgactggggctacggctgtggccattgcccggcc
tgcgccttgcgcaagaacggttgggagcgctgggtggccggcgcggcgcacgcggattga

DBGET integrated database retrieval system