KEGG   Bordetella pertussis Tohama I: BP0763
Entry
BP0763            CDS       T00139                                 

Symbol
cyaE
Name
(GenBank) cyclolysin secretion protein
  KO
K12340  outer membrane protein
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe01501  beta-Lactam resistance
bpe01503  Cationic antimicrobial peptide (CAMP) resistance
bpe02020  Two-component system
bpe03070  Bacterial secretion system
bpe05133  Pertussis
Module
bpe_M00575  Pertussis pathogenicity signature, T1SS
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BP0763 (cyaE)
  09132 Signal transduction
   02020 Two-component system
    BP0763 (cyaE)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    BP0763 (cyaE)
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BP0763 (cyaE)
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BP0763 (cyaE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpe02000]
    BP0763 (cyaE)
   02044 Secretion system [BR:bpe02044]
    BP0763 (cyaE)
   01504 Antimicrobial resistance genes [BR:bpe01504]
    BP0763 (cyaE)
Transporters [BR:bpe02000]
 Other transporters
  Pores ion channels [TC:1]
   BP0763 (cyaE)
Secretion system [BR:bpe02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   BP0763 (cyaE)
  RTX toxin transporter
   BP0763 (cyaE)
  Multiple protein transporter
   BP0763 (cyaE)
  RaxAB-RaxC type I secretion system protein
   BP0763 (cyaE)
Antimicrobial resistance genes [BR:bpe01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AcrEF-TolC [MD:M00696]
    BP0763 (cyaE)
   Multidrug resistance, efflux pump MdtEF-TolC [MD:M00697]
    BP0763 (cyaE)
SSDB
Motif
Pfam: OEP
Other DBs
NCBI-ProteinID: CAE41069
UniProt: P0DKY0
Position
784885..786309
AA seq 474 aa
MAAVQVRRRGRALALALWAGFALSVGGGVRARDGLATPPAFEGQAAPAVSWPCPPPADRL
DDLALLEAIDLALCHSPALRQGWARIKARSAEVGLARAPYYPSVALSAGRSAQRRSTGLG
EDGVRNNVMAVTLAWRLFDSGARSAALRAAQAQLDEAAQAYGAVLQDKLAEVVGAYYEAA
TARQALHTAVEDTEIARRSASIAARRARAGLDSHGDVLHAQAALERARLAQAQAEGAQAR
ALAGLAQVLGVDPATPIVLAPGPLAPQRIEDRELAQWLRDARQRHPAIKAAQAGLAAATA
QVDVARATDMPTVDLSLGHYRNSSENVSVFAGSSRSVSASLNLRIPLFDGFARRHRIQGA
RAEVQRQEALLDQARLATGAAVARAYADLRAARASHEASLRWLKAARAAYESDLRRYEAG
VGGVAELLRAQSDWLSARQRHVLYAAQLRTRALALLAAAGELGRSTIDGDPPKE
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggccgcggtgcaagtcaggcgacgcggccgggccctggcgttggcgctgtgggccggg
ttcgcgctgagcgtgggaggcggggtgcgggcgcgcgatggcctggcaacgccgcccgcg
ttcgagggccaggcggcgcctgccgtctcgtggccttgtccgccgccggcggatcggctc
gacgacctggccttgctcgaggcgatcgacctggcgctgtgccacagcccggccttgcgc
cagggttgggcgcggatcaaggcgcggtcggccgaggtcgggctggcgcgtgcgccctat
tatcccagcgtcgcgttgagcgccgggcgttcggcgcagcggcgcagcacggggttgggc
gaggacggggttcgcaacaatgtgatggcggtaacgctggcctggcgcctgttcgactcg
ggcgcccgttcggccgccctgcgggcggcacaggcgcaactggacgaggccgcgcaggcc
tatggcgcggtgctgcaggacaagctggccgaagtggtcggcgcctattacgaggcggcc
acggcgcggcaggcgctgcatactgcggtggaagacacggagatcgcccggcgttcggcc
agcatcgcggcgcgccgcgcgcgcgcaggcctggacagccacggcgatgtgctgcatgcg
caggctgccctggagcgcgcgcgcctggcgcaggcgcaggccgaaggcgcgcaggcacgc
gcgctggccggcctggcgcaggtcctgggcgtcgatccggccacgccgatcgtcctggcg
ccgggtccgctggcgccgcaacggatcgaagatcgggagctggcccaatggctgcgggac
gcccggcagcgtcatcccgcgatcaaggcagcgcaggcgggcctggcagcggccaccgcc
caggtcgatgtggcgcgggccacggatatgccgacggtggatctttcgctgggccattat
cgcaacagtagcgagaacgtctcggtgttcgccggttcgtcgcgcagcgtgtccgccagt
ctgaacctgcggattccgctgttcgacggattcgcccggagacatcggatccagggcgcg
cgcgccgaagtgcagcgccaggaggctctgctcgaccaggcccgcctggcgaccggcgcg
gccgtggcgcgcgcctatgccgatctgcgggctgcgcgcgccagccatgaggccagcttg
cgctggctgaaggccgcgcgagccgcttacgagtcggacctgcgccgctacgaggcgggg
gtgggcggcgtcgcggagctgctgcgcgcgcaatccgactggctgtcggcccggcagcgc
cacgtgctgtatgccgcccagctgcgcacccgcgcgctggccctgctggccgcggcggga
gagctgggccgttcgacgatcgacggcgatccgcctaaggagtaa

DBGET integrated database retrieval system