KEGG   Bordetella pertussis Tohama I: BP0840
Entry
BP0840            CDS       T00139                                 

Name
(GenBank) outer membrane porin protein precursor
Organism
bpe  Bordetella pertussis Tohama I
SSDB
Motif
Pfam: Porin_4 Porin_1 TAtT
Other DBs
NCBI-ProteinID: CAE41143
UniProt: Q04064
Position
869226..870383
AA seq 385 aa
MKKTLLAAALLAGFAGAAQAETSVTLYGIIDTGIGYNDVDFKVKGANADDSDFKYNHSRF
GMINGVQNGSRWGLRGTEDLGDGLQAVFQLESGFNSGNGNSAQDGRLFGRQATIGLQSES
WGRLDFGRQTNIASKYFGSIDPFGAGFGQANIGMGMSAMNTVRYDNMVMYQTPSYSGFQF
GIGYSFSANDKDADAVNRVGFATADNVRAITTGLRYVNGPLNVALSYDQLNASNNQAQGE
VDATPRSYGLGGSYDFEVVKLALAYARTTDGWFGGQGYPVAVTLPSGDKFGGFGVNTFAD
GFKANSYMVGLSAPIGGASNVFGSWQMVDPKLTGGDEKMNVFSLGYTYDLSKRTNLYAYG
SYAKNFAFLEDAKSTAVGVGIRHRF
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaaaaagactctgctcgctgccgccctgctcgccggtttcgccggtgccgctcaggca
gaaacgtcggtcaccctgtacggtatcatcgacacgggtatcggctacaacgatgtcgat
ttcaaggtgaaaggcgctaacgccgacgacagcgacttcaagtacaaccacagccgcttc
ggcatgatcaacggcgtgcagaacggttcgcgctggggtctgcgtggtacggaagatctg
ggtgacggcctgcaagctgtgttccaactggaatcgggcttcaactcgggcaacggtaac
tcggcccaagacggccgcctgttcggtcgccaagccaccatcggtctgcaaagcgaaagc
tggggccgtctggacttcggtcgccaaaccaacatcgcctcgaagtacttcggctcgatc
gatccgttcggcgctggcttcggtcaagccaacatcggcatgggcatgagcgcgatgaac
accgttcgctacgacaacatggtcatgtaccagaccccgtcgtacagcggcttccagttc
ggtatcggctactcgttcagcgcgaacgacaaggatgctgacgccgtcaaccgcgttggc
ttcgccaccgccgacaacgttcgtgccatcacgaccggtctgcgctacgtgaacggcccg
ctgaacgtcgctctgtcgtacgaccagctgaacgcctcgaacaaccaagcccaaggcgaa
gttgacgcgaccccgcgcagctacggcctcggcggttcgtatgacttcgaagtcgtgaag
ctggctctggcctacgctcgcacgaccgacggctggttcggtggccaaggctacccggtc
gccgtcacgctgccctcgggcgacaagttcggcggcttcggcgtgaacaccttcgctgac
ggcttcaaggccaactcgtacatggtcggcctgtcggcccccatcggcggcgccagcaac
gtgttcggttcgtggcagatggttgaccccaagctgaccggcggcgacgagaagatgaac
gtcttctcgctgggctacacctacgacctgtccaagcgcaccaacctgtacgcctacggt
tcgtacgccaagaacttcgcgttcctggaagatgccaagtcgaccgctgtcggcgtcggt
atccgtcaccgcttctaa

DBGET integrated database retrieval system