KEGG   Bordetella pertussis Tohama I: BP0856
Entry
BP0856            CDS       T00139                                 
Symbol
bfrD
Name
(GenBank) probable TonB-dependent receptor for iron transport
  KO
K16090  catecholate siderophore receptor
Organism
bpe  Bordetella pertussis Tohama I
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpe02000]
    BP0856 (bfrD)
Transporters [BR:bpe02000]
 Other transporters
  Pores ion channels [TC:1]
   BP0856 (bfrD)
SSDB
Motif
Pfam: TonB_dep_Rec Plug OMP_b-brl_3
Other DBs
NCBI-ProteinID: CAE41159
UniProt: P81549
Position
885872..888103
AA seq 743 aa
MKFYSSHPMPESLAAAIAVPLLGLLPAAQAASTAVQLPSVTVEGEYSSYQPESAQSPKFT
APLADTPRTVQVIPERLIQDQGASDLEAVLRNAPGISMTAGEGGRPASDLPFIRGQNSAS
SLFVDGLRDPSTQSRDTFNLEQVDVVKGPDSVFSGRGGAGGSINLVTKTPRNQDFTEVQA
GIGTAETYRGTIDGNWVLGENTALRLNLLGTRDTVPGRDKAVEFSRVGIAPSLRLGLSGP
TRVTLGLYHYRHRRVPDYSIPYDPRTGTPITETIGVSRRNFYGLVRRDSGDTEDYAATVK
WEHDLANGFKVENLARYSRATVEQITTMPELKTADLAKGLVYRNLRASYQVNDSFANRTD
LRGTFDTGQWRHTFDLGGEFATSRRSRDRYKQEIPDAASPCSPVTDGNNPALCASLRDPD
PHVDFPGTVRRNHNPARYHTDILSLYGFDTIAFDEQWQLNLGLRWDHYKTSGRNLPVRGA
KPPVYERAARTDNLFNYQLGLVYKPRPDGSVYASYGTASTPSAVSDYAPADSISGTSQQL
KPERSEAIEIGTKWQVLDRRLLVTGAMFRETRKNTSIEVAEGLRAPAGKSRVTGMELGVA
GSLTPRWDVYGGYALLDSKLVRASHKSGAQGQPLPSAPRHAFSIWSTYKLLPELTVGAGA
FYRSKVYGNADAGYNKDGTPKARWVPAYWRFDAMAAYQLNKHLTAQLNVYNLLDKTYYAK
TYRSHYAALGPGRSAMLTFKLSY
NT seq 2232 nt   +upstreamnt  +downstreamnt
atgaagttctactcttcccatccgatgcccgagtcgctcgcggctgcgatcgcagtgcct
ctgttgggcctgctgccggcggcgcaggccgcgtccacggcggtccagctgccatccgtc
acggtcgagggcgagtactcgtcctatcaaccggaaagcgcccagtcgcccaagttcacc
gcgcccctggcggacacgccgcgcacggtgcaggtcatccctgagcggctcatccaggac
cagggggccagcgacctcgaagcggtactgcgcaatgcgccagggatatcgatgaccgcc
ggcgaaggcggccgtccggccagcgacctgccgttcatccgcggccagaattcggccagc
agcctttttgtcgacggcctgcgcgatcccagcacgcaatcgcgcgataccttcaacctg
gaacaggtcgacgtcgtcaaggggcccgattcggtattttccgggcgcggcggcgccggc
ggaagcatcaacctcgtcaccaagacgcccaggaaccaggatttcaccgaagtccaggcc
ggcatcgggacggccgagacctaccgaggcaccatagacggcaactgggtgctgggcgag
aacacggcgctgcgcctcaacctgctgggcaccagggacaccgtgccgggccgcgacaag
gcggtcgagttcagccgcgtgggtatcgcgccatcgctgcgcctgggcctgagcggcccc
acccgcgtgacgctgggcctgtaccactatcgccaccggcgggttcccgattattcgatt
ccgtacgatccgcgcaccggcacgccgatcaccgagaccatcggcgtcagccgccgcaac
ttctacggcctggtgcggcgcgactccggcgataccgaggactacgccgccaccgtcaaa
tgggagcacgacctcgccaatggcttcaaggtggagaacctggcgcgctactcgcgtgcc
acggtggagcagatcaccaccatgcccgaactgaaaaccgccgatctggccaaggggctg
gtgtaccgcaatctgcgcgccagctaccaggtcaacgacagtttcgccaaccgcaccgac
ctgcgcggtacattcgacacggggcagtggcgccataccttcgatctgggcggggagttc
gccaccagccggcgcagtcgcgaccgctacaagcaagaaatccccgacgccgccagtcct
tgctcgcccgtgacggacggcaacaatcccgccctgtgcgcctcgctccgggatccggat
ccgcacgtggatttcccgggaacggtgcggcgcaaccataacccggcccgctaccacacc
gacatcctgtccctgtacggtttcgacaccatcgccttcgacgagcagtggcagctgaat
ctcggcctgcgctgggaccactacaagaccagcggacgcaacctgccggtacgaggcgcc
aagccgcccgtctacgagcgtgccgcgcgcaccgacaacctgttcaactaccagctcggc
ctggtctacaagcctcgtccggacggctcggtgtatgcgagttacggcacggcgtccacg
ccgtcggccgtgtccgactacgccccggcggacagcatctccggcacaagccagcagctc
aagccggagcgcagcgaggcgatcgagatcgggaccaagtggcaggtgctggaccggcgg
ctgctggtgacgggcgccatgttccgcgagacgcgcaagaacaccagcatcgaagtcgcc
gaaggcctgcgcgcaccagccggcaagagccgcgtcaccggcatggagctgggcgtggcg
ggcagcctgacgccgcgctgggacgtctacggcggctacgcgctgctcgacagcaagctg
gtcagggccagccataagagcggggcgcaaggccagccgctgcccagcgcgccccggcac
gcattcagcatctggagcacctacaagctgctgccggaactgaccgtgggggccggcgcg
ttctatcgcagcaaggtctatggcaacgcagatgccggctacaacaaggacggcacgccc
aaggcgcgctgggtgccggcgtactggcgcttcgacgccatggcggcgtaccagcttaac
aagcaccttacggcccagttgaacgtctacaacctgctcgacaagacctattacgccaag
acctaccgcagccattacgcggcgctgggcccggggcggtccgccatgctgacgttcaag
ctgagctactga

DBGET integrated database retrieval system