KEGG   Bordetella pertussis Tohama I: BP1593Help
Entry
BP1593            CDS       T00139                                 

Definition
(RefSeq) non-canonical purine NTP pyrophosphatase
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BP1593
Enzymes [BR:bpe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     BP1593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-GeneID: 2666612
NCBI-ProteinID: NP_880326
UniProt: Q7VXX8
Position
1671806..1672447
Genome map
AA seq 213 aa AA seqDB search
MSAEILNPNLRRVVLASNNAGKLREFSALFAPLGIELVPQSELGVSEAEEPHATFVENAL
AKARHASRHTGLPALADDSGLCVVALGGAPGVHSARYAQQPGGARSDAANNALLVRELAA
AGDRRAWYVALLALVRTENDPCPLIGEGLWHGEIVDAPAGEHGFGYDPHFYLPQQGCTAA
QLAPEHKNRISHRAQALAQLLDKLRATGPVDRP
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcagaaatactcaatccaaacttgcgtcgcgtggtgcttgcatccaacaatgcc
ggcaaattgcgcgaattctcggccctgttcgccccgcttgggatagaactggtgccgcaa
agcgaattgggcgtctcggaggccgaggagcctcacgccacctttgtcgagaacgcgctg
gccaaggcccgccacgccagccggcataccggcctgccggccctggccgacgattcgggc
ctgtgcgtggtggcgctgggcggggcgccgggcgtgcattcggcccgctacgcccagcag
cccggcggcgcccgcagcgacgcggccaacaacgccttgctggtgcgcgagctggccgcg
gccggcgaccggcgcgcctggtatgtggcgctgctggcgctggtgcgcaccgagaacgat
ccctgtccgctcattggcgaagggctctggcacggcgagatcgtcgatgcgccggccggc
gagcatggcttcggctacgacccgcatttctatctgccgcagcagggttgcaccgccgcc
caactggcgccggagcacaagaaccgcatcagccaccgggcgcaggccctggcgcagctg
ctggacaagctgcgcgcaaccgggccggtggaccggccctag

DBGET integrated database retrieval system