KEGG   Bordetella pertussis Tohama I: BP1882Help
Entry
BP1882            CDS       T00139                                 

Gene name
fimC
Definition
(RefSeq) outer membrane usher protein FimC
  KO
K07347  outer membrane usher protein
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe05133  Pertussis
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    BP1882 (fimC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpe02000]
    BP1882 (fimC)
   02044 Secretion system [BR:bpe02044]
    BP1882 (fimC)
   02035 Bacterial motility proteins [BR:bpe02035]
    BP1882 (fimC)
Transporters [BR:bpe02000]
 Other transporters
  Pores ion channels [TC:1]
   BP1882 (fimC)
Secretion system [BR:bpe02044]
 Chaperone-usher system
  Type 1 pilus assembly protein
   BP1882 (fimC)
Bacterial motility proteins [BR:bpe02035]
 Pilus system
  Fimbrial proteins
   BP1882 (fimC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Usher PapC_N PapC_C
Motif
Other DBs
NCBI-GeneID: 2667065
NCBI-ProteinID: NP_880573
UniProt: P33410
Position
1981113..1983734
Genome map
AA seq 873 aa AA seqDB search
MKQIPLILAMSLAFAAAAKGESAPDMQAAVNFDSAMLWGGANGADLSRFNYSNALRPGNY
IVDIYANNYPLIRQQVRFVAAQTSGQGLKTAPAVACFTYGQLEAMQVRLRALDPALVADL
KSSGRCEVLGKLFPDSRESFDFGENRLEVSIPQAYTINRFRRDISPDEWDSGITAFRLGY
QYNYADYIGGLRAGRRLDLNLYSGFNFKGWYLRNSSTLGWGQGRFTRRSQRTSLQTDIPS
WRARLVFGDVFSSGEYFAPYSMRGMLVGSDTAMLPYSERLYRPTIRGVARTRANVKVYQA
GVLVFQDAVPPGPFAIDDYSPASYGGDLRVVVTEANGAVQTFTVPYASAVRLILPGQTQW
SFSAGRYRNYRNDGQDRPWVTQLTGRHGVADGVNLYGGLLIAQAYQAGLAGLSWNTPWGA
MAADATLSRSQLSTTGNANGSSLRFSYSKTLSGTNTAIRLATLRYSSSGFWNFADAVNAG
PVETNGRNGRFGLYSLLGRERPRGDFSVTLSQPLGGYGSLYVSALRRTYWGSSRVDQQTQ
LGYSTQVGRVGVNLDVSRTENRRSTEHQVMLNLSIPLYGATSSGVVTGSLARTGSAPVQQ
SVNYSGMSGERDQYTYGLGVQRAGTSAQYALNGSWSGTYGEVSGQLTHGRSYSQYQINGS
GGLVAHAGGVTFGQYQAGTIGLIQAEAAAGAKVVNTRNAAVDRSGYGLVSLTPYSLNEVE
LSPQDLPLDVQLESTVEQVIPRAGAVVALRFPTRHDVAAMLVAEPGSEGALVFGTEVRDG
AGKVVGVAGQGASALVRGVSASGTLEVTRADGSICRATYDLKSAGQAVHGLPRIALACAP
QGGGERGARAAGQAVAQPSAISISGKDHEPDIR
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagataccactgattctcgcgatgagccttgccttcgccgccgcggcgaagggc
gaatccgcgccggatatgcaggcggcggtcaacttcgactcggccatgctgtggggcggc
gccaatggcgcggatctgagccgattcaactacagcaacgcgctgcggccgggcaactac
atcgtcgacatttacgccaacaactatccgctgatccggcagcaggttcgattcgtcgcg
gcgcagacgtccgggcagggcttgaagacggcgccggcggtggcgtgtttcacctatggc
cagctggaagcgatgcaggtccggctgcgcgcgctcgatccggccttggtcgccgacctc
aaatccagcgggcgctgcgaggtgctgggcaagctgttcccggatagccgcgagtcgttc
gatttcggcgagaaccgcctggaagtcagcattccgcaagcctatacgatcaaccgcttc
cggcgcgacatctcgcccgatgagtgggatagcggcattactgcgttccgcctgggatac
cagtacaactatgccgattacatcggcggcttgcgcgcggggcggcggctggacctgaac
ctctacagcgggttcaatttcaagggctggtacctgcgcaacagctcgacgctgggatgg
ggccagggccgcttcacgcgccgcagccagcgcaccagcctgcagacggatatcccgtcc
tggcgggcgcgcctggtgttcggcgacgtgttctccagcggcgagtacttcgcgccgtac
tcgatgcgcggcatgctggtcggcagcgataccgccatgctgccgtactcggagcgcctg
taccggccgaccatacgcggcgttgcgcgcactcgggccaacgtcaaggtgtatcaggcc
ggcgtgctggttttccaggacgccgtgcctcccgggccgttcgcgatcgacgattacagt
ccggcctcgtatggcggcgacctgcgggtggtggtgaccgaggcgaatggcgcggtccag
acgttcaccgtgccgtacgccagcgcggtgcgcctgatcctgccgggccagacgcagtgg
tcgttcagcgccgggcgctatcgcaactatcgcaacgatgggcaggaccgtccctgggtg
acccagctgacgggccgccatggcgtggccgacggcgtcaacctgtacggcggcctgctg
atcgcccaggcgtaccaggccggcctggccggcctgagctggaacacgccctggggggca
atggcggcggacgccacgctgtcgcgcagccagctgtccaccaccggcaatgccaacggg
tcgagcctgcggttctcctacagcaagaccttgtccggcaccaacacggcgatccggctg
gctacgctgcgctactcgtcgagcgggttctggaatttcgccgatgcggtcaatgccggc
ccggtcgagacgaacgggcgcaacgggcggttcggactctattcgctgctgggccgcgag
cggccgcgcggcgatttcagcgtcacgctgagccaaccgctgggtggatacggcagcctg
tacgtgtcggcgctgcggcggacctactggggttcgtcgcgggtcgaccagcagacccag
ctgggctattcgacccaggtcggccgcgtaggcgtgaacctggatgtctcgcgtacggag
aatcgtcgcagcaccgagcatcaggtcatgctgaatctgtccattccgctttatggcgcg
acctccagcggcgtggtgacgggatcgctggcgcgtaccggctcggcgcccgtacagcaa
agcgtcaactacagcggcatgtcgggcgagcgcgatcagtacacctatggcctgggcgtg
cagcgcgccggcacgagcgcgcagtacgcgttgaacggctcctggtcaggcacgtacggg
gaggtaagcggacagctcacccatgggcgcagctacagccagtaccagatcaacggcagc
ggcggcttggtggcgcacgcgggcggcgtgaccttcggccagtaccaggcgggcaccatc
ggcctgatccaggccgaggcggcggcaggcgcaaaggtcgtcaatacgcgcaacgccgcc
gtggaccgcagcggctatgggctggtgtcgctgacgccgtattccctcaacgaggtcgaa
ctgtctccgcaggacctgcccctggacgttcagctggagtccacggtggagcaagtcatc
ccgcgggcgggcgccgtcgtggcgctgcgctttccgacgcgccatgacgtcgccgccatg
ctggttgccgaacccggcagcgaaggcgcgctggtattcggcaccgaagtgcgcgacggc
gccggcaaggtggtgggcgtggccggccagggcgcaagcgcgctggtcagaggcgtgtcg
gcatcgggcacgctggaggtgacgcgcgcagacggttcgatatgccgcgccacgtacgac
ttgaaatcggccgggcaagccgtgcatggcctgccgcgcattgcgctggcgtgcgcgccg
caaggcggcggcgaacgtggtgcgcgggcggcgggccaggccgtggcgcagccatcagct
atctccatttcgggtaaagatcatgagccagatattcgctga

DBGET integrated database retrieval system