KEGG   Bordetella pertussis Tohama I: BP2057Help
Entry
BP2057            CDS       T00139                                 

Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K02000  glycine betaine/proline transport system ATP-binding protein [EC:3.6.3.32]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe02010  ABC transporters
Module
bpe_M00208  Glycine betaine/proline transport system
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BP2057
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpe02000]
    BP2057
Enzymes [BR:bpe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.32  quaternary-amine-transporting ATPase
     BP2057
Transporters [BR:bpe02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Glycine betaine/proline transporter [MD:M00208] [OT]
    BP2057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_22 AAA_16 AAA_21 ATPase_2 ABC_ATPase AAA_29 RsgA_GTPase AAA_33 CBS AAA_30 Viral_helicase1 SbcCD_C AAA_18 AAA_24 AAA_15 AAA_23
Motif
Other DBs
NCBI-GeneID: 2666583
NCBI-ProteinID: NP_880723
UniProt: Q7VWX7
Position
2176914..2178176
Genome map
AA seq 420 aa AA seqDB search
MSKIEVKNIYKIFGPHPGKWLQAARDGISKEDLLAKSGHTLGLRDISLSIEEGSIYVIMG
LSGSGKSTLIRHFNRLIEPSAGHILVDGVDVVSLNKRDLETFRQKKMSMVFQRFGLFPHR
TVLDNAGYGLAVQGVARAEREQRARHWLDQVGLSGFENQYPHQLSGGMQQRVGLARALAT
DAEILLMDEAFSALDPLIRREMQDHLLQLQAKLNKTIVFITHDLDEALRLGNRIAILKDG
ELVQEGTPEDILLNPATEYVQSFLQDVNRTKVLNAAHAVNPPRLTLTMRSRPAHALDRMQ
ALSYEYAPVLDGKRLAGVLMAAAAQQAVDEGARDVSRFVEDLASVPATAGLDQVLAQLVH
SDQPVAVTGEGDEFIGMLSRKKVVELVTPVLAESDSADGQGDAADAASDGAGQAHERDAA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatcgaagtcaagaatatctacaagatcttcggcccgcatcccggcaagtgg
ctgcaggccgcccgcgacggcatcagcaaggaagacctgctggccaaaagcggccacacg
ctgggcctgcgcgacatcagcctgtccatcgaggaaggcagcatctacgtgatcatgggg
ctgtcggggtcgggcaagtcgacgctcatccgccacttcaaccgcctgatcgagcccagc
gccggccatatcctggtcgatggcgtggatgtggtcagcctgaacaagcgcgacctggag
acgttccgccagaagaagatgagcatggtcttccagcgctttggcctgttcccccaccgc
acggtgctggacaacgccggctacgggctggcggtgcagggcgtggcgcgcgcagagcgc
gaacagcgggcccgccattggctcgaccaggtaggcctgtccggcttcgagaaccagtat
ccccaccagttgtcgggcgggatgcagcagcgcgtggggttggcgcgggcgctggccacc
gacgccgagatcctgttgatggacgaagccttctcggccctggacccgctgatccgccgc
gagatgcaggaccacctgctgcagctgcaggccaagctgaacaagaccatcgtgttcatc
acgcacgacctggacgaggcgctgcgcttgggcaaccgcattgcgatcctgaaggacggc
gagctggtgcaggaaggcacgccggaagacatcctgctcaatcccgccaccgaatacgtg
cagtcgttcctgcaggacgtcaaccgcaccaaggtgctcaacgcggcgcacgcggtcaac
ccgccgcgcctgaccttgacgatgcgctcgcggccggcgcatgcgctggaccgcatgcag
gcgctgagctacgagtacgctccggtgctcgatggcaagcgcctggcgggcgtgctgatg
gccgccgccgcgcagcaggcggtggacgagggcgcgcgcgatgtgtcgcgcttcgtcgag
gacctggcctcggtgccggccaccgccggcctggaccaggtgctggcgcagctggtgcac
agcgaccagccggtggcggtgacgggcgagggcgacgagttcatcggcatgctgtcgcgc
aagaaggtggtcgagctggtcacgccggtgctggccgagtccgactcggccgacgggcag
ggcgatgctgcggacgcggcctcggacggcgcggggcaggcgcacgagcgcgacgcggcc
tga

DBGET integrated database retrieval system