KEGG   Bordetella pertussis Tohama I: BP2063Help
Entry
BP2063            CDS       T00139                                 

Definition
(RefSeq) hypothetical protein
Organism
bpe  Bordetella pertussis Tohama I
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 2666589
NCBI-ProteinID: NP_880729
UniProt: Q7VWX1
Position
2182893..2183699
Genome map
AA seq 268 aa AA seqDB search
MSRAMKPNSPPGQILCRIDAGVAHVTLSHPGRMNAMTVAMWRQLREVFEALGADAALRCV
VVAGAEGHFAAGADIREFPAERADLAGVQRYHREILAPALAAVAACPHPVLARIEGVCVG
GGLEIAAQCDLRIAAESARFGVPIGKLGFPMAPDEMRGLLDLVGRAVTLAILLEGRVFDA
AEALRLGLVTRTVPAAELDQAVQRSVAAILGGAPQAARLNKRQARRLCAGAPLGEDEYLD
FFSYAESRDHREGVRAFLAGTAPTFTGD
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgccatgaagccgaattccccgcccgggcagatcctgtgccgcatcgacgcc
ggcgtggcccatgtcacgctgagccatccgggccgcatgaatgccatgacggtcgcgatg
tggcggcagctgcgcgaggtcttcgaggccctcggggccgacgctgcgctgcgctgcgtg
gttgtcgccggcgccgaagggcatttcgccgccggcgccgacatccgcgagtttccggcc
gaacgcgccgacctggccggggtgcagcgctatcaccgcgagatcctggcgccggcgctg
gccgcggtggccgcctgcccgcatcccgtgctggcccgtatcgagggcgtgtgcgtgggc
ggcggcctggagatcgccgcgcagtgcgatctgcgcatcgccgccgagtcggcccgcttc
ggcgtgccgatcggcaagctgggctttccgatggcgccggacgaaatgcgcggcctgctc
gacctggtcggccgcgcggtgacgctggccatcctgctcgaagggcgcgtcttcgacgcc
gccgaagcgctgcgcctggggctggtcacgcgcacggtgcccgcggccgaactggaccag
gcggtgcagcgcagcgtggccgccatcctgggcggcgccccgcaggcggcgcgcctgaac
aagcgccaggcgcgccgcctgtgcgccggcgcgccgctgggcgaagacgaatacctggat
ttcttttcctatgccgaaagccgcgaccaccgggagggcgtgcgcgccttcctggccggc
acggcccccacatttaccggagactag

DBGET integrated database retrieval system