KEGG   Bordetella pertussis Tohama I: BP2068Help
Entry
BP2068            CDS       T00139                                 

Definition
(RefSeq) exported protein
  KO
K01989  putative ABC transport system substrate-binding protein
Organism
bpe  Bordetella pertussis Tohama I
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpe02000]
    BP2068
Transporters [BR:bpe02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Putative ABC transporter [MD:M00247] [OT]
    BP2068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_sub_bind Glyco_trans_4_4 PGAP1 DUF3157 DUF3235
Motif
Other DBs
NCBI-GeneID: 2666593
NCBI-ProteinID: NP_880732
UniProt: Q7VWW8
Position
2187243..2188217
Genome map
AA seq 324 aa AA seqDB search
MLIGKKHFLTVGALALAMAIHAAPVMAQQKSVAITAIVEHPALDSVRDGVQDALKQAGYE
SGKNLKWQYQSAQGNTGTAAQIARKLVGDRPDVIVAIATPSAQAVVAATKDVPVVYSAVT
DPVAAQLVPSMEASNTNVTGVSDLLALDKQIELIKKVVPNAKRVGMVYNPGEANSVVVVK
QMQDLLPKAGMTLVEAAAPRTVDVASAARSLIGKVDVIYTNTDNNVVSAYESLVKVGNDA
KIPLVASDTDSVKRGAIAALGINYRDLGVQTGKMVVRILKGEKPGAMPSETSSKLELYVN
PGAAAKQGVTLSDALVKSAAQVIK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcggaaaaaaacattttctgacggtaggcgcgctggcgctggcgatggctatc
cacgccgcaccggtcatggcgcagcagaaatcggtggcgatcacggccatcgtcgaacac
cccgcgctcgattccgtgcgcgacggcgtacaggacgccctgaagcaggcgggttacgaa
tcgggcaagaatctgaagtggcaataccagagcgcccagggcaacaccggcacggccgcg
cagattgcgcgcaagctcgtcggcgaccgccctgacgtgatcgtggcgatcgccacgccg
tcggcccaggccgtggtggcggccaccaaggacgtgccggtggtgtattcggccgtgacc
gacccggtggccgcgcagttggtgccctcgatggaggcctccaacaccaacgtcacgggc
gtgtccgacctgttggcgctggacaagcagatcgagctgatcaagaaggtggtgcccaat
gccaagcgcgtgggcatggtctacaacccgggcgaagccaactcggtcgtggtcgtcaag
cagatgcaggacctgctgcccaaggccggcatgacgctggtcgaggcggccgcgccgcgc
acggtggacgtggcctcggccgcgcgcagcctgatcggcaaggtcgacgtcatctatacc
aacaccgacaacaacgtcgtttcggcgtacgagtcgctggtcaaggtgggcaacgacgcc
aagatcccgctggtggcttcggacaccgacagcgtcaagcgcggcgcgatcgccgcgctg
ggcatcaactaccgcgacctgggcgtgcagacgggcaagatggtggtgcgcatcctcaag
ggcgaaaagcccggcgccatgccctccgagaccagctccaagctggagctctacgtgaat
ccgggcgccgccgccaagcagggcgtgacgctgtccgacgcgctggtcaagtccgcggcg
caagtcatcaagtaa

DBGET integrated database retrieval system