KEGG   Bordetella pertussis Tohama I: BP2073Help
Entry
BP2073            CDS       T00139                                 

Definition
(RefSeq) hypothetical protein
  KO
K07001  NTE family protein
Organism
bpe  Bordetella pertussis Tohama I
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BP2073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3734 Patatin
Motif
Other DBs
NCBI-GeneID: 2667082
NCBI-ProteinID: NP_880736
UniProt: Q7VWW4
Position
2191556..2192734
Genome map
AA seq 392 aa AA seqDB search
MSKRKARRGAGMLDYETVALVLQGGGALGAYQAGVYEGLHAAGIRPNWLAGISIGGINAA
IIAGAPVDERVGRLRGFWEAICRPTGFAGLPWGDAWAALFANAPFGFGSNQSNGQLAAFN
ALTRGQPGFFEPRFPPPYLVQGGGAAATSFYDTTPLLQTLRDYVDFDLLNRGDVRVSLGA
VNVRTGNFAYFDSRETVIRPEHVMASGALPPGFPAIEIDGEFYWDGGLVSNTPLTKVLAV
HPMRDTLAFQVDLWPARGPLPASLEEVAERQKDIQYSSRTRIVTDTFRRQLKLRRSLQRV
LDRLPARVRSSPELAEVRREACTPLVNVVNLIYEANQFERHSKDYEFNTESMREHWRFGL
ADIERTLAQPGVLDKPSPDESFVTHDIHRADA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcgcaaggcgcgccgcggcgccggcatgctcgactacgagacggtggcgctg
gtgctgcagggcggcggcgccctgggcgcgtaccaggccggcgtctacgagggtctgcat
gccgcgggcatacggccgaactggctggccggcatttccatcggcggcatcaatgcggcc
atcatcgccggcgcccccgtggacgaacgggtcgggcgcctgcgcggcttctgggaagcc
atctgccggcccaccggattcgccgggctgccctggggcgatgcctgggcggcgctgttc
gccaacgcgccgttcggcttcggctccaaccagagcaacggccagctggctgccttcaac
gcgctcacgcgcggccagccggggtttttcgagccgcgctttccgccgccgtacctggtg
caggggggcggggcggccgcgaccagcttctacgacacgacgccgctgctgcagacgctg
cgcgactatgtcgatttcgacctgctcaaccgcggcgatgtgcgggtcagcctgggggcg
gtcaacgtacgcaccggcaatttcgcctacttcgacagccgcgagaccgtcatcaggccc
gagcacgtcatggcttccggcgcgctgccgcctggctttcccgccatcgagatcgatggc
gagttctactgggacggcggtctggtgtccaacaccccgctgaccaaggtgctggcggtc
cacccgatgcgcgacacgctggctttccaggtcgacctgtggccggcgcgcggccccttg
cccgccagcctggaagaggtggcggagcgccagaaggatatccagtactccagccgcacg
cgcatcgtcaccgatacgttccgccgccagctcaagctgcgccgcagcctgcagcgcgtg
ctcgaccgcctgcctgcgcgggtgcgcagcagccccgagctggccgaggtccggcgcgag
gcctgcacgccactggtcaacgtggtcaacctcatctacgaggccaaccagttcgaacgc
cattccaaggactacgagttcaataccgagtcgatgcgggagcactggcgcttcggcctg
gccgacatcgaacgcacgctggcgcagcccggcgtgctggacaagccgtcgcccgacgag
agtttcgtgacgcacgacatccaccgcgcggacgcttga

DBGET integrated database retrieval system