KEGG   Bordetella pertussis Tohama I: BP2074Help
Entry
BP2074            CDS       T00139                                 

Definition
(RefSeq) DNA-binding protein
Organism
bpe  Bordetella pertussis Tohama I
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C
Motif
Other DBs
NCBI-GeneID: 2667083
NCBI-ProteinID: NP_880737
UniProt: Q7VWW3
Position
2192837..2193211
Genome map
AA seq 124 aa AA seqDB search
MSLRRSASFPAAKPSAGAQPWELRYQAWVLVTPAGAIVHLSAAERICMLGLLAHPRRELT
RAALVQSLPGLGAGAINVVISRLRRKVGETGEVLPLRTVHGMGYVFLAGLRSDTAPPQAT
PAAG
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgtccctccgtcgttccgcttcctttcccgccgccaagccgtccgccggggcgcagccc
tgggagctgcgttaccaggcctgggtgctcgtcacgccggccggcgccatcgtgcatctg
tcggccgccgaacgcatctgtatgctgggcctgcttgcgcatccccggcgcgagctcacc
cgcgcggcgctggtccagagcctgcccgggctgggcgcgggcgccatcaacgtggtcatc
agccgtctgcgccgcaaggtgggcgagaccggcgaggtcttgccgctgcgcaccgtgcac
ggcatgggctatgtgttcctggccggcttgcgcagcgacaccgcgccgccgcaggcgacg
cccgccgcgggttga

DBGET integrated database retrieval system