KEGG   Bordetella pertussis Tohama I: BP2079Help
Entry
BP2079            CDS       T00139                                 

Gene name
acpS
Definition
(RefSeq) holo-ACP synthase
  KO
K00997  holo-[acyl-carrier protein] synthase [EC:2.7.8.7]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe00770  Pantothenate and CoA biosynthesis
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BP2079 (acpS)
Enzymes [BR:bpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.7  holo-[acyl-carrier-protein] synthase
     BP2079 (acpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACPS
Motif
Other DBs
NCBI-GeneID: 2667088
NCBI-ProteinID: NP_880741
UniProt: Q7VWV9
Position
2200429..2200890
Genome map
AA seq 153 aa AA seqDB search
MSSVSAAGATPPASPGCIAGIGMDLLRIERIERALARHGDRFAQKILGPKELAKFQARRR
RDPARGVRFLATRFAAKEAFSKAIGLGMRMPMSWRRVQTLNAPGGRPVLVIGAELADWFD
ARFGAAHVSITDESDMAAAYVIVERKPAPDGRP
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgtttccgcggccggcgcgacgccgcccgcgtcgcccggctgcatcgccggc
atcggcatggacctgttgcgcatcgaacgcatcgagcgcgcgctggcgcgccatggcgac
cgtttcgcgcagaagatcctggggccgaaggagctggccaagttccaggcgcgccgccgc
cgcgacccggcgcgcggcgtgcgtttcctggccacccgctttgccgccaaggaagccttt
tccaaggccatcgggctgggcatgcgcatgcccatgagctggcgacgggtgcagaccctg
aatgcgccgggcgggcggccggtgctggtgatcggcgccgagctggccgattggttcgat
gcgcgcttcggcgcggcgcatgtgtccattaccgacgagtccgatatggccgcggcctac
gtcatcgtcgaacgcaaaccggcgcccgacggccggccgtga

DBGET integrated database retrieval system