KEGG   Bordetella pertussis Tohama I: BP2086Help
Entry
BP2086            CDS       T00139                                 

Definition
(RefSeq) membrane protein
Organism
bpe  Bordetella pertussis Tohama I
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5379 Fig1
Motif
Other DBs
NCBI-GeneID: 2665445
NCBI-ProteinID: NP_880747
UniProt: Q7VWV3
Position
2208637..2209272
Genome map
AA seq 211 aa AA seqDB search
MACFMALVLARFGFGFCMLLAALMLLVAATLLATRLVGWAVRAFALERSQALASGVAIFL
LVALALWGCHAVGEILYGAIGATALVGGAPHWLAGNSHVSAAALMGATTAAAMLAGGPAF
WRWLRARRAAAAEQPAPRKAAPPKGAKPAARAAKAAAKTQIAPRGQRIPWLGWTAFFLLF
IGAAVLAFAYIVSPIEAGARCELSIGCIRPG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgcttcatggccctggttctggcccgtttcgggtttggtttctgcatgctgctg
gcggcgctgatgctgctggtggcggcgacgctgctggctacccggctggtagggtgggcc
gtgcgcgctttcgcgctggagcgttcgcaggcgctggccagcggcgtggcgattttcctc
ctggtggcgttggccctgtggggctgccatgcggtgggcgagatcctgtatggcgccatc
ggcgccacggccctggtgggcggcgcgccccattggctggcgggcaacagccacgtgtcg
gccgcggccttgatgggcgccaccacggcggcggccatgctggccggcggcccggctttc
tggcgctggctgcgcgcccggcgcgccgccgcggccgagcagccggcgccccgcaaggcg
gcgccgcccaagggggcgaagccggccgcccgcgccgccaaggccgctgccaagacgcag
atcgccccgcgcggccagcgcattccctggctgggctggacggctttcttcctgttgttc
atcggcgcggccgtgctggcgttcgcctatatcgtctcgcccatcgaagccggcgctagg
tgtgaactgtcaataggttgtattcgtccaggttga

DBGET integrated database retrieval system