KEGG   Bordetella pertussis Tohama I: BP2094Help
Entry
BP2094            CDS       T00139                                 

Definition
(RefSeq) 3-oxoacyl-ACP reductase
Organism
bpe  Bordetella pertussis Tohama I
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10 ApbA TrkA_N GDP_Man_Dehyd
Motif
Other DBs
NCBI-GeneID: 2666996
NCBI-ProteinID: NP_880754
UniProt: Q7VWU7
Position
2216113..2216835
Genome map
AA seq 240 aa AA seqDB search
MPRHALVTGGANGIGAATVAQLCRDGLRVTFCDRDAQAGASVAEATGARFVALDATDAEA
VAGFCAGAAPFDILVNNVGADQHAFFSRTTPQDWRALLAVNLESAFAFTLGVLPGMQAAR
FGRIVNVSSEAGRLGSRGGAVYAAAKAGLLGFTRSIARENARYGVTANAVLPGPVDTPML
ARAVDVAGAQMRADLEALTLLRRLGRPEEVAAAIAFLCSEAAGFITGEALGVSGGMGCGA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgccgcggcacgcgctcgttaccggcggcgccaacggcatcggcgcggccaccgtcgcg
cagctatgccgcgacggcctgcgcgtcacgttctgcgatcgcgacgcgcaggcgggcgcc
agcgtggccgaggccaccggcgcccgctttgtcgcgctcgacgccacggacgccgaggcg
gtggccggattctgcgccggcgccgcgccgttcgacatcctggtcaacaatgtcggcgcc
gaccagcacgcgttcttttcccggacgaccccgcaggactggcgcgcgctgctggccgtc
aacctggagagtgcgttcgccttcacgctgggcgtgctgcccggcatgcaggcggcgcgc
ttcggccgcatcgtcaatgtgtcgtccgaggcgggccgcctgggttcgcgcggcggggcg
gtctacgccgccgccaaggcgggcctgctcggattcacccgctcgattgcgcgcgagaac
gcgcgctacggcgtgaccgccaatgccgtgctgcctggaccggtcgacacgccgatgctg
gcgcgcgccgtcgacgtcgcgggcgcgcagatgcgcgccgacctggaggcgttgacgctg
ctgcgccgcctgggccggcccgaggaggtcgccgcggcgattgcgtttttatgctccgaa
gccgccggcttcatcaccggcgaggcgctgggcgtctccggcgggatgggctgcggcgct
tga

DBGET integrated database retrieval system