KEGG   Bordetella pertussis Tohama I: BP2095Help
Entry
BP2095            CDS       T00139                                 

Definition
(RefSeq) ferredoxin
  KO
K04755  ferredoxin, 2Fe-2S
Organism
bpe  Bordetella pertussis Tohama I
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2
Motif
Other DBs
NCBI-GeneID: 2666997
NCBI-ProteinID: NP_880755
UniProt: Q7VWU6
Position
2216857..2217171
Genome map
AA seq 104 aa AA seqDB search
MTTIIFIASNEARHIVQADDGLSLMECARRANVPGIAAECGGACTCATCHVHVGQEWMQA
VGEPGDMERDMLDFANDVRAESRLSCQITVAPALEGLTVRVAPQ
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgattattttcatcgcctccaatgaggctcgccacatcgtccaggcggacgac
ggattgagcctgatggagtgcgcccggcgcgccaatgtgccgggcatcgcggccgagtgc
ggcggcgcgtgcacctgcgccacctgccatgtgcatgtgggacaggaatggatgcaggcc
gtgggcgaacccggcgacatggagcgcgacatgctggacttcgccaacgatgtccgcgcc
gagtcgcgtctttcctgccagattacggtcgcgccggcgctggaagggctgaccgtcagg
gtcgcgccgcagtga

DBGET integrated database retrieval system