KEGG   Bordetella pertussis Tohama I: BP2098Help
Entry
BP2098            CDS       T00139                                 

Definition
(RefSeq) acyl-CoA ligase
Organism
bpe  Bordetella pertussis Tohama I
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding_C_2 AMP-binding
Motif
Other DBs
NCBI-GeneID: 2667000
NCBI-ProteinID: NP_880758
UniProt: Q7VWU3
Position
complement(2219240..2220559)
Genome map
AA seq 439 aa AA seqDB search
MLHPEIELLDRDGILKIQRERLARLGQRLQHSPQWREHFASVGMTPGDLASPDAFEHLPF
LQKADLRQQYPYPFLTVPLEDVERFVATSGTTGLPVMFGLTRRDLHELLPSQTARLLAAA
GVRRGARAYQGYGYGLWIGGLALDQGFKAMDCVNFPLGPGRGDLAARWMRDHAYEVASMS
PLWLMSLAQAARAQGINPKTDWALRTAILGGQSVSAEFRAQLEAEMPEGFVSHNIYGTTE
AGGPILAISTPYTHADDELHLINEDTVLTEILDPVTLKPVSEGEVGEIVITTLTKEASPV
IRWRTHDLVRLSSHPYDCPSGRRGMRKIGRIIGRSDDMIKFKGVIVFPSQIEDVITGVAG
VVKEAWQIYIDKECMTIGTMTVAIEASAQAGRPAEQLSNEVGREIHARLGMKVCVECHPE
GTLPRYEAKAVRVLHRPEA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaccctgagatagaactgctggaccgagacggcatcctcaagatccagcgcgag
cggctggcccgattgggccagcgcctgcagcacagcccgcaatggcgcgagcatttcgcc
agcgtcggcatgacgcccggcgaccttgcctcgccggacgccttcgaacacctgcccttc
ctgcagaaggccgacctgcgccagcagtatccctacccgttcctgaccgttcccctcgaa
gacgtggagcggttcgtcgccacctcgggcaccaccggcctgccggtgatgttcggcctg
acgcggcgcgacctgcacgagctgctgcccagccagaccgcgcgcctgctggccgcggcg
ggcgtgcgccgcggcgcgcgcgcctaccagggctacggctacggcctgtggatcggcggc
ctggcgctggaccagggcttcaaggcaatggactgcgtcaacttcccgctgggcccgggc
cgcggcgacctggcggcgcgctggatgcgcgaccatgcctacgaagtggcctcgatgtcg
ccgctgtggctgatgagcctggcgcaggccgcgcgcgcccagggcatcaaccccaagacc
gactgggcgctgcgcaccgccatcctgggcggccagtcggtctcggccgaattccgcgcc
cagctggaagcggaaatgcccgaaggattcgtgtcgcacaacatctacggcaccaccgag
gcgggcggcccgatcctggccatctcgacgccgtacacgcacgccgacgacgaactgcat
ctcatcaatgaagacacggtgctgaccgagatcctggatccggtcacgctcaagccggtc
tccgaaggggaagtgggcgagatcgtcatcaccaccctgaccaaggaagcctcgcccgtg
atccgctggcgcacgcatgacctggtcaggctgtcgtcgcacccctacgactgcccgtcg
ggacggcgcggcatgcgcaagatcggacgcatcatcgggcgctccgacgacatgatcaag
ttcaagggcgtgatcgttttcccgtcgcagatcgaggacgtcatcaccggcgtcgccggc
gtggtcaaggaagcctggcagatctatatcgacaaggaatgcatgaccatcggcaccatg
accgtggcgatcgaggcgtccgcccaggccggccgcccggccgaacagctcagcaatgaa
gtgggccgggaaatccacgcgcgcctgggcatgaaggtctgcgtcgaatgccatcccgaa
ggcacgctgccgcgctacgaagccaaggccgtgcgcgtactgcatcgtcccgaagcatga

DBGET integrated database retrieval system