KEGG   Bordetella pertussis Tohama I: BP2099Help
Entry
BP2099            CDS       T00139                                 

Definition
(RefSeq) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe00071  Fatty acid degradation
bpe00072  Synthesis and degradation of ketone bodies
bpe00280  Valine, leucine and isoleucine degradation
bpe00310  Lysine degradation
bpe00362  Benzoate degradation
bpe00380  Tryptophan metabolism
bpe00620  Pyruvate metabolism
bpe00630  Glyoxylate and dicarboxylate metabolism
bpe00640  Propanoate metabolism
bpe00650  Butanoate metabolism
bpe00900  Terpenoid backbone biosynthesis
bpe01100  Metabolic pathways
bpe01110  Biosynthesis of secondary metabolites
bpe01120  Microbial metabolism in diverse environments
bpe01130  Biosynthesis of antibiotics
bpe01200  Carbon metabolism
bpe01212  Fatty acid metabolism
bpe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BP2099
   00630 Glyoxylate and dicarboxylate metabolism
    BP2099
   00640 Propanoate metabolism
    BP2099
   00650 Butanoate metabolism
    BP2099
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BP2099
   00072 Synthesis and degradation of ketone bodies
    BP2099
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BP2099
   00310 Lysine degradation
    BP2099
   00380 Tryptophan metabolism
    BP2099
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BP2099
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BP2099
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BP2099
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpe04147]
    BP2099
Enzymes [BR:bpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BP2099
Exosome [BR:bpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BP2099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 2667001
NCBI-ProteinID: NP_880759
UniProt: Q7VWU2
Position
complement(2220632..2221828)
Genome map
AA seq 398 aa AA seqDB search
MATGIKDRVAILAMGCSRFGERWDVGQEELMVEAYAEALASAGIEPRAIEAAWYSSHYDD
IGAGKAGTPMAMALRLPDIGVTRVENFCAGGTEAFRGAVYAVASGAADIALALGVEKLKD
TGFAGLPLASRGTLAPMYLLTHSNPGNFAQLARAYQARHGVAREDLKAAMAHTSMKSHAN
ALHNPKAHLRKAISREQAAGAPLVADPIGLFDCCPVSDGAACAIVTTPEIARSLNRGPLV
LVKAIQLATSNGWELQQSDWDGSYVHTTRVAARKAYAEAGIDDPRAQLSLTELHDCFSIT
ELVTLEDIGLAEPGTAWRGMLDGRFDADGALPCQIDGGRKCFGHPVGASGLRMLYEAWLQ
LSGRAGARQLPAPSLALTHNLGGAPAQNVCSITILGAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctacaggaatcaaggatcgcgtcgccattctggcgatgggctgttcccgtttcggc
gaacgctgggacgtgggccaggaagaattgatggtcgaggcctacgccgaggcgctcgcg
agcgccggcatcgagccgcgcgccatcgaggcggcctggtactcgtcgcactatgacgac
atcggcgcgggcaaggccggcacgcccatggccatggccctgcgcctgcccgacatcggc
gtgacgcgcgtggagaacttctgcgccggcggcaccgaagcgtttcgcggcgccgtctac
gcggtcgcctccggcgccgcggacatcgcgctggcgctcggggtggaaaagctgaaagac
accggcttcgccggtctgccgctggcctcgcgcggcacgctggcgcccatgtacctgctc
acgcacagcaacccgggcaacttcgcgcagctggcccgtgcctaccaggcccgccacggc
gtggcccgggaggacctcaaggcggccatggcccatacctcgatgaaaagccatgccaac
gccttgcacaatcccaaggcgcacctgcgcaaggccatcagccgcgaacaggccgccggc
gcgccgctggtggccgaccccatcggactgttcgattgctgtccggtgtcggacggcgcc
gcctgcgccatcgtcaccacccccgagatcgcccgcagcctgaaccgcggcccgctggtc
ctggtcaaggccatccagctggccacgtccaacggctgggagctgcagcaatcggactgg
gacggctcgtacgtgcacaccacccgcgtggcggcgcgcaaggcgtacgccgaagcgggc
atcgacgatccgcgcgcgcagctcagcctgaccgaattgcacgactgcttctcgatcacc
gaactggtgacgctggaggacatcggcctggccgagcccggcacggcctggcgcggcatg
ctcgacggccgcttcgatgccgacggggcgctgccctgccagatagacggcggccggaaa
tgcttcggccatcccgtgggggcctcggggctgcgcatgctctacgaggcctggctgcaa
ctgagcggccgcgccggcgcgcgccagctgcccgcgccctcgctggccctgacccacaat
ctgggcggcgcgcccgcgcagaacgtgtgttcgatcacaatactcggcgcggcttga

DBGET integrated database retrieval system