KEGG   Bordetella pertussis Tohama I: BP2107Help
Entry
BP2107            CDS       T00139                                 

Definition
(RefSeq) hypothetical protein
  KO
K06886  hemoglobin
Organism
bpe  Bordetella pertussis Tohama I
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BP2107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_globin
Motif
Other DBs
NCBI-GeneID: 2666206
NCBI-ProteinID: NP_880766
UniProt: Q7VWT6
Position
2230603..2231007
Genome map
AA seq 134 aa AA seqDB search
MGAPDLCTEEDITQLVHQFYAEVRRDAELGPIFNTHVDDWDVHLAKLVDFWSSILRGTGR
FRGTPMPRHVALPGLHAGLFERWLRLFRATAAAQPNQAMAEQACLMAGRIAQSLWYGYQL
HRSPDQAPTDLAHG
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgcgcccgatctctgtaccgaagaagacatcacgcaactggtgcaccagttctac
gccgaagtgcggcgcgacgccgagttgggaccgatcttcaacacccatgtcgacgactgg
gacgtccacctcgccaagctggtcgacttctggtcgtcgatactgcgcggcaccggacgc
tttcgcggcacgcccatgcccaggcacgtggccctgcccggcctgcacgcgggcctgttc
gagcgctggctgcggctgtttcgcgccaccgccgcggcgcagcccaaccaggccatggcc
gaacaggcctgcctgatggccggccgcatcgcgcaaagcctgtggtacggctatcagctg
caccgcagccccgaccaggcccccacggacctcgcccatggctga

DBGET integrated database retrieval system