KEGG   Bordetella pertussis Tohama I: BP2110Help
Entry
BP2110            CDS       T00139                                 

Definition
(RefSeq) exodeoxyribonuclease III
  KO
K01142  exodeoxyribonuclease III [EC:3.1.11.2]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BP2110
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bpe03400]
    BP2110
Enzymes [BR:bpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     BP2110
DNA repair and recombination proteins [BR:bpe03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     BP2110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exo_endo_phos AbiEi_3
Motif
Other DBs
NCBI-GeneID: 2666209
NCBI-ProteinID: NP_880769
UniProt: Q7VWT3
Position
2232739..2233521
Genome map
AA seq 260 aa AA seqDB search
MKLATWNVNSLNVRLPQVLDWLAANPVDALCIQELKLTDDKFPLDAFTEAGYHAAWAGQK
TYNGVAIISREPGFALVRNNPRYEDPQQRILAVTLPSPAGDVRVICAYCPNGQSVDSDKY
VYKLAWFDGLRDWLEEEMRTYPRLAILGDYNVAPADADVHNPEKWEGQVLVSEPERAAFR
ALLDLGLTDSFRLFEQPEKSFSWWDYRQFAFRRNAGLRIDHVLLSDALKPHCVACVIDKA
PRANEQPSDHAPVIATLAFD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactcgcgacttggaacgtcaactccctgaatgtgcgcctgccgcaggtgctggac
tggctggccgccaatccggtcgatgcgctgtgcatccaggaactcaagctgaccgacgac
aaattcccgctcgacgcctttaccgaggccggctaccacgccgcctgggccggccagaag
acctataacggcgtggccatcatctcgcgcgagcccggcttcgcgctggtgcgcaacaac
ccgcgctacgaagacccgcagcagcgcatcctggccgtgaccctgcccagcccggccggc
gacgtgcgcgtgatctgcgcctattgccccaacggccagtcggtcgacagcgacaagtac
gtctacaagctggcctggttcgacggcctgcgcgactggctcgaggaagaaatgcgcacc
tatccgcgcctggccatcctgggcgactacaacgtcgcgccggccgacgccgacgtgcac
aaccccgagaaatgggaaggccaggtgctggtctccgagcccgaacgcgcggccttccgc
gcgctgctggacctgggcctgaccgactccttccgcctgttcgagcagcccgagaaatcc
ttcagctggtgggactaccgccagttcgcgttccgccgcaacgccggcctgcgcatcgac
catgtgctgctgtccgacgcgctcaagccgcactgcgtggcctgcgtcatcgacaaggcg
ccgcgcgccaacgaacagccgtccgaccacgcgccggtcatcgccaccctggcgttcgac
tga

DBGET integrated database retrieval system