KEGG   Bordetella pertussis Tohama I: BP2121Help
Entry
BP2121            CDS       T00139                                 

Definition
(RefSeq) transposase for IS1663
Organism
bpe  Bordetella pertussis Tohama I
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transposase_20 DEDD_Tnp_IS110 Prefoldin
Motif
Other DBs
NCBI-GeneID: 2667626
NCBI-ProteinID: NP_880777
UniProt: Q7TTD7
Position
complement(2244646..2245662)
Genome map
AA seq 338 aa AA seqDB search
MADSSLLSAGGQVHVFIGIDVSKAKLDCTLLTAEADKRKTKVVVNTAAGVQALLAWCAKH
GAQPAQLHAILEPTGLYHEQAATALPQVRVSLVNPAQARDFAKALALRSKNDALDSYVLA
RYGQTLSPALWHPAPLHARQLRALLTRREALSKDLLRELNRKEKSQFSPSAPVVDGSIDK
AIAFLREQIKQIERAIDQHIDNHPDLKQDCELLNSIPAIGPQAGNAILAVMHNRHIDSAQ
SLAAYLGVVPVQRQSGSSLNSCARLSKAGPSQVRATLYMAALVGTRHNPHIRALYQRLLK
AGKSKKAALGAAMRKLVHLCFGVLKNRIPYQPNYAMNG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacagcagtttgttatctgcaggaggccaagtccatgttttcataggtattgat
gtatcaaaggccaagctggattgcacgttgctgacggctgaggctgacaagcgtaagacc
aaggtggtggtcaacaccgccgcgggcgtacaagccctgctggcgtggtgcgccaaacac
ggcgcacagccggcgcagttgcacgccatcctggagcctacgggtctgtatcacgagcaa
gcggccacggcgctgccccaggtccgggtctctttggtcaatcccgcccaggcccgggac
tttgccaaggccttggcgctgcgctccaaaaatgatgcgctcgacagctacgtgctggct
cgctatggacagacgctgagcccggcgctgtggcacccggcgcccttgcatgcgcgtcaa
ctgcgcgccttgttgacgcgacgcgaggcgctgagcaaggatctgttgcgtgagctcaat
cgcaaagagaagagccagttcagcccctcggcgcccgtggtcgatggttccatcgacaag
gccatcgcgttcttgcgcgaacagatcaaacaaatcgagcgggcgatcgatcagcacatc
gacaaccaccccgacctcaagcaagactgcgagctgctgaactccatccccgccatcggg
cctcaggccggcaacgccatcctggccgtcatgcacaatcggcatatcgactccgcccag
agcctggccgcctatctcggggtggtccctgtgcagcgccaatccggcagcagtctgaac
agctgcgcacgcctgtccaaagccggcccctcccaggtgcgcgccacgttatacatggcg
gccctggttgggacccgccacaacccccacatccgcgccctttaccagcgcctgctcaaa
gcaggaaaaagcaaaaaggccgcgctgggcgcggccatgagaaaactggtgcatctgtgc
ttcggggtcctcaaaaaccgcatcccctaccagcccaattacgccatgaacggttga

DBGET integrated database retrieval system