KEGG   Bordetella pertussis Tohama I: BP2126Help
Entry
BP2126            CDS       T00139                                 

Definition
(RefSeq) oxidoreductase subunit
  KO
K07302  isoquinoline 1-oxidoreductase subunit alpha [EC:1.3.99.16]
Organism
bpe  Bordetella pertussis Tohama I
Brite
Enzymes [BR:bpe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.16  isoquinoline 1-oxidoreductase
     BP2126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_2 Fer2 Fer2_3 Gly_rich_SFCGS Fer2_4 OSK
Motif
Other DBs
NCBI-GeneID: 2667632
NCBI-ProteinID: NP_880781
UniProt: Q7VWS2
Position
2250306..2250764
Genome map
AA seq 152 aa AA seqDB search
MPTLNINGKDTVLDAPGEMPLLWALRDVADLTGTKYGCGMALCGACTVHADGQPIRACIT
PVQAVAGRRIVTIEGVAADRTGQAVQQAWRELDVAQCGYCQSGQIMSAAALLRANPAPTD
RDIDDAMNGNICRCATYVRIRAAIHAAAAALA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgctcaatatcaatggcaaggacaccgtactggacgcccccggcgagatgccg
ctgctgtgggccctgcgcgatgtggccgacctgaccggcaccaagtacggttgcggcatg
gcgctatgcggcgcctgcaccgtgcacgccgacggccagcccatccgcgcctgtatcacg
cccgtgcaggcggtcgccggccgccgcatcgtcaccatcgaaggcgtggccgccgaccgc
accggccaggccgtgcagcaggcctggcgcgaactggatgtggcccagtgcggctactgc
cagtcgggccagatcatgtccgccgccgccctgctgcgcgccaatcccgcccccaccgac
cgcgacatcgacgacgccatgaacggcaatatctgccgttgcgccacgtacgtgcgcatc
cgcgccgccatccacgccgccgccgcggccctggcctga

DBGET integrated database retrieval system