KEGG   Bordetella pertussis Tohama I: BP2129Help
Entry
BP2129            CDS       T00139                                 

Definition
(RefSeq) AraC family transcriptional regulator
Organism
bpe  Bordetella pertussis Tohama I
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AraC_N HTH_18 HTH_AraC
Motif
Other DBs
NCBI-GeneID: 2667635
NCBI-ProteinID: NP_880784
UniProt: Q7VWR9
Position
2254081..2255055
Genome map
AA seq 324 aa AA seqDB search
MSALPDSPSASPPPRHDELASLIERHTPADGSTATALPGLNFYRSSSPTELNVSFYRPSL
ALLAQGAKRVQLGDDVYEYDTSHYLLTSFDLPVASRVTLATPGTPYLCFALDLDPHRIAG
LISELGAPPAGQPLRRGLTLARLTEPLLDAVLRLARLLDTPADIPVLAPLIEREIHYRLL
SGPMGGRLRHIARAEGTALQIARAIDWLRRHYAQPLRVEHLATTVNMSVSSLHHHFKAVT
ALSPLQYQKQLRLHEAHRLMVAETLDAGAAAHRVGYESASQFSREYSRLCGAPPLRDAAR
LRGTAPADAQSPGLARASASATVS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccctgcccgactccccatccgccagcccgccgccgcgccacgacgaactggcc
agcctgatcgaacggcatacgccggccgacggcagcaccgcgaccgccctgccgggcctg
aacttctaccgttcgtccagcccgaccgaactgaacgtcagcttctaccggccgtcgctg
gcgctgctggcgcagggcgccaagcgcgtgcagctgggcgacgacgtctacgaatacgac
acctcgcactacctgctgacctcgttcgacctgccggtggcctcgcgcgtcacgctggcc
accccgggcacgccctacctgtgctttgcgctcgacctggatccgcaccgcatcgccggc
ctgatcagcgagctgggcgccccgccggccggccagccgctgcgccgcggcctgacgctc
gcgcgcctgaccgagcccttgctcgacgccgtgctgcgcctggcgcgcctgctcgacacg
ccggccgacatcccggtgctggccccgttgatcgagcgcgaaatccactaccgcctgctg
tccggtccgatgggcgggcggctgcgccacatcgcgcgcgccgagggcacggcgctgcag
atcgcgcgcgccatcgactggctgcgccggcactacgcgcagccgctgcgcgtggaacac
ctggccacgaccgtcaacatgagcgtgtcgtcgctgcatcaccatttcaaggccgtcacc
gcgctcagcccgctgcaataccagaagcagctgcgcctgcacgaggcgcaccggctgatg
gtggccgaaaccctggacgccggcgcggccgcccaccgggtcggctacgaaagcgcgtcg
caattcagccgcgaatacagccgcctgtgcggcgcgccgccgctgcgcgacgcggcgcgc
ttgcgcggcacggccccagccgacgctcagtcgcccggcttggcgcgcgcctcggccagc
gccacggtcagctga

DBGET integrated database retrieval system