KEGG   Bordetella pertussis Tohama I: BP2170Help
Entry
BP2170            CDS       T00139                                 

Definition
(RefSeq) cytochrome C oxidase subunit
  KO
K00405  cytochrome c oxidase cbb3-type subunit II
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe00190  Oxidative phosphorylation
bpe01100  Metabolic pathways
bpe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BP2170
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BP2170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FixO Cytochrom_C Clostridium_P47
Motif
Other DBs
NCBI-GeneID: 2665993
NCBI-ProteinID: NP_880819
UniProt: Q7VWN7
Position
2291835..2292497
Genome map
AA seq 220 aa AA seqDB search
MAQKQHGFFSHQTLEKNIGLMIIASILVVSVAGLVQIIPLFFQHSTTQAMPGVEPYEPLQ
LMGRDVYIREGCVGCHSQQVRTLQAEVQRYGPYSVAGESVFDHPFLWGSKRTGPDLARVG
ERYSDEWHRIHLRDPRAVVPESNMPAYPWLQHADLTGQNVAQRMQALRRLGVPYTDEAIA
AAPAAIAGKTEEDALVAYLQALGVGARRGAASEPQRAAGG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtggcacagaaacaacatggctttttctcccaccagacgctggagaagaacatcggcctg
atgatcatcgccagcatcctggtggtgtccgtcgccgggctggtgcagatcatcccgctg
ttcttccagcactcgaccacccaggccatgcccggggtggagccctacgagccgctgcag
ctgatggggcgcgacgtgtacatccgcgaaggctgcgtgggctgccactcgcagcaggtg
cgcaccctgcaggccgaggtgcagcgctacggcccgtattcggtggcgggggagtcggtg
ttcgaccatcccttcctgtggggctccaagcgaaccggccccgacctggcgcgcgtgggc
gagcgctattccgacgaatggcaccgcatccacctgcgcgatccgcgcgccgtggtgccc
gagtccaacatgcccgcctatccgtggctgcagcatgccgacctgaccggccagaacgtg
gcccagcgcatgcaggcgctgcgtaggctgggcgtgccgtacaccgacgaggccatcgcg
gcggcgccggcggccatcgccggcaagaccgaagaggacgccctggtggcctatctgcag
gcgctgggcgtgggcgcgcggcgcggcgccgccagcgagccgcaacgcgcggcgggaggc
tga

DBGET integrated database retrieval system