KEGG   Bordetella pertussis Tohama I: BP2173Help
Entry
BP2173            CDS       T00139                                 

Definition
(RefSeq) ferredoxin
Organism
bpe  Bordetella pertussis Tohama I
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_18 FixG_C Fer4_5 Fer4_7 Fer4_8 Fer4_9 Fer4_17 Fer4_10 Fer4 Fer4_6 Fer4_21 Fer4_2 Fer4_3
Motif
Other DBs
NCBI-GeneID: 2665996
NCBI-ProteinID: NP_880822
UniProt: Q7VWN4
Position
2293703..2295193
Genome map
AA seq 496 aa AA seqDB search
MTQGTPAAPGGPSDPQPPAWRPAPGPRRADGETLEQTLADVRSKIYPRSVSGIFARWRVV
FVVLTQLIFYGLPWLQWNGRQAVLFDLGARKFYLFGLVLWPQDVVYLAVLLVISALALFL
FTAVAGRLFCGYACPQTVYTEIFMWIERRVEGDRIARIRLDEAPWSARKLRIKATKHVLW
LAVAWWTGSTFIGYFAPIRELGHQLFALQLGGWQWFWMLFYGFATWGNAGFMRESVCKYM
CPYARFQSVMVDHDTFVVTYDKRRGEPRGGRSRKIDHKAAGLGDCVDCSLCVQVCPTGID
IRDGLQYMCIGCGACIDVCGQVMDKMRYAPGLIRYTSERAVDEGLDGRRARSHLLRPRVL
IYGGLILALAIAFAVSLGMRNPLRVNVIRDRGALGREVAGGLVENVYRLQIINTSDQPLR
LQLTAEGIDGLAVLAGRDGSDVVEVEAAANKLVPVVLRAPRGDTAPGAHAIVVQARSQDT
GRVLEVREPASFYLPE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagggacaccggccgcgcctggcggcccgtccgatccgcagccgccggcctgg
cggcccgctcccggcccgcggcgcgccgacggagaaacgctggagcagacgctcgccgat
gtgcgcagcaagatctatccgcgctcggtcagcggcatattcgcgcgctggcgcgtcgtg
ttcgtggtcctgacccagttgatcttctacggtctgccgtggctgcagtggaacggccgg
caggccgtgctgttcgacctgggcgcgcgcaagttctatctgttcgggctggtgctgtgg
ccgcaggacgtggtgtacctggccgtgctgctggtgatcagcgcgctggcgctgttcctg
ttcacggccgtcgccggtcggctgttctgcggctatgcctgcccgcagacggtctatacc
gaaatcttcatgtggatcgagcgccgcgtcgaaggcgaccgcattgcgcgcatccgcctg
gacgaagcgccgtggagcgcgcgcaagctgcgcatcaaggccaccaagcacgtgctgtgg
ctggcggtggcatggtggaccggctcgacgttcatcggctacttcgcgcccatccgcgag
ctgggccatcagctgttcgcgctgcaactgggcggctggcaatggttctggatgctgttc
tacggtttcgccacctggggcaacgccggcttcatgcgcgaatcggtctgcaagtacatg
tgcccgtacgcgcgcttccagagcgtgatggtcgatcacgacacgttcgtggtgacctac
gacaagcggcgcggcgagccgcgcggcggccgctcgcgcaagatcgaccacaaggcggcg
ggcctgggcgactgcgtcgattgcagcctgtgcgtgcaggtctgtccgaccggcatcgac
atccgcgacggcctgcagtacatgtgcatcggttgcggcgcctgtatcgacgtgtgcggc
caggtcatggacaagatgcgctatgcgccgggcctgatccgctatacgtccgagcgggcc
gtggacgagggcctggacggccggcgcgcgcgctcgcacctgctgcgcccgcgcgtgctg
atctacggcgggttgatcctggcgctggcgatcgccttcgcggtgtcgctgggcatgcgc
aaccccttgcgcgtgaacgtgatccgcgaccgtggcgcgctgggccgcgaggtggccggc
ggattggtcgagaacgtataccgcctgcagatcatcaatacgtccgaccagcccctgcgc
ctgcagctgacggccgagggcatcgacggcctggccgtgctggccggccgcgacggctcg
gacgtggtggaggtcgaggccgccgccaacaagctggtgccggtggtgctgcgcgcgccg
cgcggcgataccgcgcccggcgcccatgccatcgtcgtgcaggcccgttcgcaggacacc
gggcgtgtgctggaagtgcgcgaacccgcaagtttctacctacccgaatag

DBGET integrated database retrieval system