KEGG   Bordetella pertussis Tohama I: BP2176Help
Entry
BP2176            CDS       T00139                                 

Definition
(RefSeq) inner membrane protein
  KO
K07090  uncharacterized protein
Organism
bpe  Bordetella pertussis Tohama I
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BP2176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-GeneID: 2665999
NCBI-ProteinID: NP_880825
UniProt: Q7VWN1
Position
2295780..2296523
Genome map
AA seq 247 aa AA seqDB search
MDALHVVVVAGAVVAGFVQGLSGFGYGLTAMSVWAWSIDPRLAAALVVFGSLTGQLIAAF
SVRRGFDWRRLLPFLLGGLVGIPIGVRILPMLDVHMFKALLGCFLVLWCPLMLAVKYLPR
ITAGGRLADAVVGGLGGVMGGIGGFTGTLPTLWCTLRGFARDEQRSIIQNFNLGTLLVTM
ATYVGTGIVTADMLPLFGLVALAMLIPTVLGTRLYLGISDQAFRRIVLGLLTLSGVAMLA
SSLPRLL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtggatgcattgcatgtcgtggtagtggccggcgcggtggtggccggcttcgtgcagggc
ctgtcgggtttcggctacgggctgaccgccatgtctgtctgggcgtggagcatcgatccg
cgcctggcggccgccctggtggtgttcgggtcgctgaccgggcaactgatcgccgccttc
tcggtgcggcgcggcttcgactggcggcggctgctgccgttcctgctgggcggcctggtg
ggcattccgatcggcgtgcgcatcctccccatgctggacgtccatatgttcaaggcgctg
ctgggctgcttcctggtgctgtggtgcccgctcatgctggcggtgaagtacctgccccgc
atcacggcgggcggccggctggccgacgccgtcgtgggcgggctgggcggcgtgatgggc
gggatcggcgggttcaccggcaccttgcccacattgtggtgcacattgcgcggctttgcc
cgcgacgagcagcgctccatcatccagaacttcaatctgggcacgctcttggttaccatg
gcgacatacgtcggcaccggcatcgtcaccgccgacatgctgccgctgttcggcctggtg
gcgctggcgatgctgattcccaccgtgctgggcacgcgcctgtacctgggcatatcggat
caggcgtttcgtcgcatcgtgctgggcctgctgaccttgtccggcgtggccatgctggcc
tcgtcgctgccccgattgctatag

DBGET integrated database retrieval system