KEGG   Bordetella pertussis Tohama I: BP2177Help
Entry
BP2177            CDS       T00139                                 

Definition
(RefSeq) hypothetical protein
  KO
K03824  putative acetyltransferase [EC:2.3.1.-]
Organism
bpe  Bordetella pertussis Tohama I
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BP2177
Enzymes [BR:bpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     BP2177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_9 Acetyltransf_7 Acetyltransf_1 Acetyltransf_10 Acetyltransf_CG FR47 CCB1 Acetyltransf_6
Motif
Other DBs
NCBI-GeneID: 2666000
NCBI-ProteinID: NP_880826
UniProt: Q7VWN0
Position
2296556..2297056
Genome map
AA seq 166 aa AA seqDB search
MLIRSETPADQRAIFDVTQAAFRGHPHSEQTEAYIVQALRAAGALTLSLVAELDARVVGH
AAFSPVQISDGSPSWFGLGPVSVDPAHQGRGIGTALIEHGLARLQARGAAGCVLVGEPAY
YGRFGFRPEPGLVLPDMPPTHFLALTFGAPARGTVTYHPGFAARDA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgctgatccgttccgaaacccccgccgaccagcgcgccatcttcgacgtgacgcaggcg
gcgtttcgcggccatccgcacagcgagcagaccgaggcgtacatcgtccaggcgctgcgc
gccgccggcgcgttgacgctgtcgctggtggccgagctcgacgcccgggtggtcggccat
gccgcgttctcgccggtgcagatttccgacggcagcccgtcgtggttcggcctgggaccg
gtgtcggtcgatccggcccaccagggccgcggtatcggcaccgccctgatcgaacacggc
ctggcgcggctgcaggcgcgcggcgcggccggttgcgtcctggtgggcgagccggcttac
tatgggcgtttcggctttcggcccgaacccgggctggtgctgccggacatgccgccgacg
catttcctggcgctgaccttcggcgcgcccgcgcgcggcaccgtcacctaccatccggga
ttcgcggcgcgcgacgcataa

DBGET integrated database retrieval system