KEGG   Bordetella pertussis Tohama I: BP2184Help
Entry
BP2184            CDS       T00139                                 

Gene name
rpoD
Definition
(RefSeq) RNA polymerase sigma factor RpoD
  KO
K03086  RNA polymerase primary sigma factor
Organism
bpe  Bordetella pertussis Tohama I
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bpe03021]
    BP2184 (rpoD)
Transcription machinery [BR:bpe03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BP2184 (rpoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_ner Sigma70_r1_1 Sigma70_r3 Sigma70_r2 Sigma70_r4 Sigma70_r1_2 GerE GAD TMPIT
Motif
Other DBs
NCBI-GeneID: 2666909
NCBI-ProteinID: NP_880832
UniProt: Q7VWM5
Position
complement(2302454..2304736)
Genome map
AA seq 760 aa AA seqDB search
MTKSTGKSPSAIDAATAQSTTAKRAASMAAEKAPAKTAVKVAKPAAKTAAKKTATKTVAA
KTAAADKPAKTTKARAKKAEDKLADLVGAARPAPSGRRPGRPAKNANNDSDAFDDSMDGE
GEVLPDLKPPKRGGKRGKADPKDLIARGPVSPEEYEARRNRLKQLIKLGKDRGYLTYGEI
NDHLPDDLVDAEAIDGIISTFSDMGIAVYDQAPDAETLLMSENAPVASNDDDVEDEAEAA
LTTVDSDFGRTTDPVRMYMREMGSVELLTREGEIEIAKRIEDGLKHMVMAISACPTTINE
ILAHITRVREGQAQIDEVVDGLVDPEDGEEYAGAGVTADEDEGDDGPAGGMSSKQLEDLR
VKALAKFDEVSKQFEKMRQSYEKEGYKSDAYLKAQDIIQTELMGIRFTAKMVEKLADTLR
AQVEEVRQLERAVLHTCVDRAGMPRSHFLKAFPGNETNLQWVLDEVAAAHAYSETLERQI
PAVQELQQKLIDLQTRVVLPLKDLKDVNKRMATGEAKARKAKREMTEANLRLVISIAKKY
TNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPV
HMIETINKMNRISRQILQETGAEPDPATLAQKMDMPEDKIRKILKIAKEPISMETPIGDD
DDSHLGDFIEDTATLAPSDAALHGSMRDVVKEVLDSLTPREAKVLRMRFGIEMSTDQTLE
EVGKQFDVTRERIRQIEAKALRKLRHPSRADKLKSFLEGQ
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatccacaggcaaatccccctctgcaatcgatgcggcaactgcccaatccacg
acggccaagcgtgctgcaagcatggcggcggaaaaggcccctgccaagactgcggtgaag
gtcgccaagcccgctgccaagacggccgccaagaagacggccaccaagacggtcgcggcc
aagacggctgccgccgacaagccggccaagaccaccaaggcgcgcgccaagaaggccgaa
gacaagctggccgacctggtcggcgccgcgcgtccggcgcccagcggccgccgtcccggc
cgccccgcgaagaacgccaacaacgatagcgatgctttcgacgactccatggacggcgaa
ggcgaagtgctgcccgacctgaagccgcccaagcgcggcggcaagcgcggcaaggccgat
cccaaggatctgatcgcccgtggccccgtctcgcccgaagaatacgaagcgcgccgcaat
cgcctcaagcagctgatcaagctgggcaaggaccgcggctacctgacctacggcgaaatc
aacgaccacctgcccgacgacctggtcgacgccgaagcgatcgacggcatcatcagcacc
ttcagcgacatggggatcgcggtctatgaccaggcccccgacgccgaaaccctgctgatg
agcgagaacgcgccggttgcctcgaacgacgacgatgtcgaggacgaggccgaggctgcc
ctcaccaccgtggactccgacttcggccggaccaccgaccccgtgcgcatgtacatgcgc
gaaatgggctcggtcgagctgctcacccgcgaaggcgaaatcgaaatcgccaagcggatc
gaggacggcctcaagcacatggtgatggccatctcggcttgtcccaccaccatcaacgaa
atcctcgcccacatcacgcgcgtgcgtgaaggccaggcccagatcgacgaagtggtcgat
ggcctggtcgaccccgaagacggcgaggaatacgccggcgccggcgtgaccgccgacgag
gacgaaggcgatgacggcccggccggcggcatgtccagcaagcagctggaagacctgcgc
gtcaaggccctggccaagttcgacgaggtgagcaagcagttcgagaagatgcgccagtcc
tatgagaaggaaggctataagtcggacgcctatctcaaggcccaggacatcatccagacc
gaactcatgggcatccgcttcacggccaagatggtcgagaagctggccgacaccctgcgc
gcccaggtcgaggaagtacgccagctcgaacgcgcggtgctgcatacctgcgtcgaccgc
gccggcatgccgcgttcgcacttcctcaaggccttccccggcaacgagaccaacctgcag
tgggtgttggacgaagtcgccgccgcccatgcctacagcgaaaccctcgaacgccagatc
ccggccgtacaggaactgcagcagaagctgatcgacctgcagacgcgcgtcgtgctgccg
ctgaaggacctcaaggacgtcaacaagcgcatggccaccggcgaagccaaggcccgcaag
gccaagcgcgaaatgaccgaggccaacctgcgcctggtgatctccatcgccaagaagtac
accaaccgtggcctgcagttcctggacctgatccaggaaggcaacatcggcctgatgaag
gcggtggacaagttcgaataccggcgcggctacaagttctcgacctacgccacgtggtgg
atccgccaggccattacgcgctccatcgccgaccaggcgcgcaccatccggattccggtc
cacatgatcgaaacgatcaacaagatgaaccggatcagccgccagatcctgcaggaaacc
ggcgccgagccggatcccgcgaccctggcgcagaagatggacatgcccgaggataagatc
cgcaagatcctgaagatcgccaaggagccgatctccatggaaacgcccatcggtgacgac
gacgactcgcacctgggcgatttcatcgaagacaccgccaccctggcgccttccgacgcg
gcgctgcacggctcgatgcgcgatgtggtcaaagaagtgttagactcgctcaccccgcgc
gaggccaaggtgctgcgcatgcgtttcggcatcgaaatgagcaccgaccagacgctggaa
gaggtgggcaagcagtttgacgtcacgcgcgagcgcatccgtcaaatagaggccaaagcg
ctgcgcaagctgcgccaccccagccgcgccgacaagctgaagagcttcctcgaagggcag
taa

DBGET integrated database retrieval system