KEGG   Bordetella pertussis Tohama I: BP2187Help
Entry
BP2187            CDS       T00139                                 

Definition
(RefSeq) transferase
  KO
K07101  uncharacterized protein
Organism
bpe  Bordetella pertussis Tohama I
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BP2187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran PRTase_2
Motif
Other DBs
NCBI-GeneID: 2666912
NCBI-ProteinID: NP_880835
UniProt: Q7VWM2
Position
complement(2307962..2308501)
Genome map
AA seq 179 aa AA seqDB search
MSSPSSDDSHLWVTWDDYHRLIERLALQVYQSGWQFDQILCLARGGVRVGDVMSRIFDVP
LGILATSSYREAAGTKQGDLDIAQFITITRGTLSGRVLLVDDMVDTGHTFNKVHTHLSEQ
FPAISELRSAVLWWKGHSQATPDYFVDKLPTNPWIHQPFEDYDSLRPHQLEAWIRKGYK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgccgagcagtgacgatagccatttgtgggtgacctgggatgattaccaccgc
ctgatcgagcgtctggcgctgcaggtgtaccagtccggctggcaattcgaccagatcctg
tgcctggcgcgcggcggcgtgcgggtcggcgatgtgatgtcccggattttcgacgtgccg
ctgggcattctggccaccagcagctatcgcgaggcggccggcaccaagcagggcgacctg
gatatcgcccagttcatcaccatcacgcgcggcaccttgtccgggcgggtgttgctggtg
gacgacatggtcgataccggccataccttcaacaaagtgcatacccatctgagcgagcag
ttccccgccatttccgagttgcgcagcgccgtgctgtggtggaaggggcattcgcaggcc
acgcccgactactttgtcgacaaattgcccaccaacccgtggatccaccagccattcgag
gactacgacagcctgcgtccgcaccagcttgaagcctggatccggaaaggctacaaatag

DBGET integrated database retrieval system