KEGG   Bordetella pertussis Tohama I: BP2462
Entry
BP2462            CDS       T00139                                 
Symbol
bcr
Name
(GenBank) putative drug resistance translocase
  KO
K07552  MFS transporter, DHA1 family, multidrug resistance protein
Organism
bpe  Bordetella pertussis Tohama I
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpe02000]
    BP2462 (bcr)
Transporters [BR:bpe02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    BP2462 (bcr)
SSDB
Motif
Pfam: MFS_1 TRI12
Other DBs
NCBI-ProteinID: CAE42734
UniProt: Q7VW14
Position
2604803..2606026
AA seq 407 aa
MSRAASAPSYSLMMVMLGLLSCVAPASIDAYLPAFGALQREFGVPQETVQLTLGVYMFCY
AAMLLLHGTLSDSLGRRRVVLGALGFYVWGALLATAAPGFGWLLAARALQGLSAGAGVVV
GQAIIRDCYQGAAAQRSMSYLILVFNLSPALAPVIGGQLAVHHGWRSIFFMLGLLAATAL
TLCAWRLPETLAPAKRQTLSLRGLAAGYREVLRNGNFTAPGLAFSLVFAAQGLLIGAAPD
FIANVLDLPETNFAYLFVPLVAGAMTGAAIAARHAGRWRDTRIIGLAYLLMNGSCLAYAI
YFWTALSPALPWAVLPPALFTCGLAMSVPAMTLHILESVPALSGTGASVLGFMQMLAFSI
ASGWGVPLTYGQPSVLALAMLACVTASALAWAWLQHLSRISAKVQAR
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgagccgcgccgcgtcggccccctcatattcgctcatgatggtaatgctggggctgctg
tcctgcgtcgcacccgccagcatcgacgcctacctgccagccttcggcgcgctgcaacgc
gagttcggcgtaccccaggaaaccgtgcaactcacgctcggcgtatacatgttctgctat
gcggcgatgctcttgctgcacggaacactgtctgactctctgggcaggcgtcgcgttgtg
ctgggcgccctgggcttctatgtttggggcgccctgcttgccacggccgcacccggtttt
ggctggctgctggcggcccgggccctgcagggactgtccgccggcgccggggtcgtggta
ggacaggccatcatccgcgattgctatcagggcgcagcggcacaacgcagcatgtcttat
ctgatcctggtgttcaatctatcgcccgcgctcgcgcccgtcatcggaggtcaattggcc
gtccatcatggttggcgttcgatcttcttcatgttggggcttctggccgccactgccctg
accctatgcgcctggcgcctaccagaaacgctcgcgcccgccaagcgccaaacgctctcc
ttgcggggtctggccgcgggctatcgtgaggtgttgcgcaatggaaatttcaccgcgccc
ggcctggcgttcagcctggtcttcgccgcacagggcctgctgatcggtgcggcgccggat
ttcatcgccaatgtgctcgatctgcccgaaaccaactttgcctatctattcgtccctctg
gtggccggcgcgatgaccggggccgcgatcgcggcgcggcatgccggacgttggcgcgat
acacggatcatcggactggcctatctgctcatgaacggtagttgcctcgcctacgccatc
tatttttggaccgccttgtcgccggcactgccctgggcggtgctgccccccgctttattc
acctgcggattggccatgtcggtgcctgccatgacgttgcacatcctggagtctgtgccc
gcgctctccggcacaggggcctcggtgctgggtttcatgcagatgctggccttttcgata
gccagcggctggggcgtaccgctgacctatgggcagccctcggtcctggccctggccatg
ctggcctgcgtgacggcaagcgcgctggcctgggcgtggttgcagcatttatcgagaata
tcggccaaggtccaggcacgctga

DBGET integrated database retrieval system